DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)mbeta-HLH and her15.1

DIOPT Version :9

Sequence 1:NP_524505.2 Gene:E(spl)mbeta-HLH / 43152 FlyBaseID:FBgn0002733 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_001353719.1 Gene:her15.1 / 100534909 ZFINID:ZDB-GENE-030707-2 Length:149 Species:Danio rerio


Alignment Length:199 Identity:53/199 - (26%)
Similarity:77/199 - (38%) Gaps:66/199 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 EMSK--TYQYRKVMKPMLERKRRARINKCLDELKDIMVECLTQEGEHITRLEKADILELTVEHMK 68
            |.||  ..:..|:.||::|:.||.|||.|:::||. |:|...|:.:...:||||||||:||..:|
Zfish     8 EYSKLSNKEKHKLRKPVVEKMRRDRINNCIEQLKS-MLEKEFQQQDPNAKLEKADILEMTVVFLK 71

  Fly    69 KLRAQKQLRLSSVTGGVSPSADPKLSIAESFRAGYVHAANEVSKTLAAVPGVSVDLGTQLMSHLG 133
                 :|||         |.......|     .||.....|....|:        :|::.::   
Zfish    72 -----QQLR---------PKTPQNAQI-----EGYSQCWRETISFLS--------VGSEAVA--- 106

  Fly   134 HRLNYLQVVVPSLPIGVPLQAPVEDQAMVTPPPSECDSLESGACSPAPSEASS-------TSGPM 191
            .||..                  |.|....|        |....|.||.:..:       ...|:
Zfish   107 QRLQQ------------------EAQRSAAP--------ELTHTSEAPHQQHTHIKQEPRAHAPL 145

  Fly   192 WRPW 195
            ||||
Zfish   146 WRPW 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)mbeta-HLHNP_524505.2 HLH 13..75 CDD:238036 26/61 (43%)
ORANGE 97..141 CDD:128787 7/43 (16%)
her15.1NP_001353719.1 HLH 19..72 CDD:306515 26/58 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170573669
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1011
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.