DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)mbeta-HLH and hes7.2

DIOPT Version :9

Sequence 1:NP_524505.2 Gene:E(spl)mbeta-HLH / 43152 FlyBaseID:FBgn0002733 Length:195 Species:Drosophila melanogaster
Sequence 2:XP_002942675.1 Gene:hes7.2 / 100496131 XenbaseID:XB-GENE-486482 Length:243 Species:Xenopus tropicalis


Alignment Length:244 Identity:59/244 - (24%)
Similarity:94/244 - (38%) Gaps:71/244 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 MSKTYQYR---KVMKPMLERKRRARINKCLDELKDIMVECLTQEGEHITRLEKADILELTVEHMK 68
            |..:|..|   ::|||::|::||.|||:.|:.|:.:::|....|.....:.||||||:.||..:|
 Frog    15 MRNSYPNREDKRLMKPVIEKRRRDRINQSLEHLRTLLLEATHDETLKNPKAEKADILKKTVHFLK 79

  Fly    69 KLRAQKQLRLSSVTGGVSPSADPKLSIAESFRAGYVHAANEVSKTLAAVPGV------------- 120
                        :.....||...||  ...|:.|:....|:.:..|.:...:             
 Frog    80 ------------MCHNPVPSDGKKL--LSGFKGGFREGLNQATSFLNSADSICQKKKEYVVQRLC 130

  Fly   121 -SVDLGTQLMSH-----LGHRLNYLQVVVPSLPI-----GVPLQAPVEDQAMVTPPPSECDSLES 174
             .::..||...|     :..|:|..| ::||.|:     |..|:...|.|.. .||.|...|..|
 Frog   131 QHMEQQTQKHCHDSAQDVSSRVNQRQ-ILPSPPLISRVTGNGLEQSPETQTS-RPPHSHHPSPSS 193

  Fly   175 GACSPA----------------------------PSEASSTSGPMWRPW 195
            ...:|.                            |:.:|..|..:||||
 Frog   194 SFRTPCMGQEQQQTPPQTFQANTNKKPTQRTLFPPTSSSVNSALVWRPW 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)mbeta-HLHNP_524505.2 HLH 13..75 CDD:238036 23/64 (36%)
ORANGE 97..141 CDD:128787 9/62 (15%)
hes7.2XP_002942675.1 HLH 22..80 CDD:238036 23/69 (33%)
ORANGE 94..138 CDD:128787 4/43 (9%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.