DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)mgamma-HLH and Hes7

DIOPT Version :9

Sequence 1:NP_524504.2 Gene:E(spl)mgamma-HLH / 43151 FlyBaseID:FBgn0002735 Length:205 Species:Drosophila melanogaster
Sequence 2:NP_149030.2 Gene:Hes7 / 84653 MGIID:2135679 Length:225 Species:Mus musculus


Alignment Length:227 Identity:56/227 - (24%)
Similarity:96/227 - (42%) Gaps:54/227 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 KVMKPMLERKRRARINKCLDELKDLMVATLESEGEHVTRLEKADILELTVTHLQKMKQQRQH--K 79
            |::||::|::||.|||:.|:||:.|::.....:.....:||||:|||..|.:|::..:....  .
Mouse    14 KMLKPLVEKRRRDRINRSLEELRLLLLERTRDQNLRNPKLEKAEILEFAVGYLRERSRVEPPGVP 78

  Fly    80 RASGDESLTPA----EGFR------SGYIHAVNEVSRSLSQLPGMNVSLGTQLMTHL-GQR---- 129
            |:.|.::...|    .|||      :.:.|..:..:||             ||.:.| |.|    
Mouse    79 RSPGQDAEALASCYLSGFRECLLRLAAFAHDASPAARS-------------QLFSALHGYRRPKP 130

  Fly   130 -----LNQIQPAEKEVLPVTAPL---SVHIANRDAYSVPISP--------ISSYAGSPNSNTSST 178
                 ::...||.:..|...:|:   ::| .....:..|.||        .||.||  :|...:.
Mouse   131 PRPEAVDPGLPAPRPPLDPASPILGPALH-QRPPVHQGPPSPRLAWSPSHCSSRAG--DSGAPAP 192

  Fly   179 SHSLLTTIDVTKMEDDSEDEENV-----WRPW 205
            ...||........:|.:....::     ||||
Mouse   193 LTGLLPPPPPPYRQDGAPKAPSLPPPAFWRPW 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)mgamma-HLHNP_524504.2 HLH 15..77 CDD:238036 22/59 (37%)
ORANGE 91..135 CDD:128787 11/59 (19%)
Hes7NP_149030.2 HLH 14..73 CDD:238036 22/58 (38%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 124..225 22/104 (21%)
WRPW motif 221..224 2/2 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167830914
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.