DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)mgamma-HLH and PIL1

DIOPT Version :9

Sequence 1:NP_524504.2 Gene:E(spl)mgamma-HLH / 43151 FlyBaseID:FBgn0002735 Length:205 Species:Drosophila melanogaster
Sequence 2:NP_182220.2 Gene:PIL1 / 819311 AraportID:AT2G46970 Length:416 Species:Arabidopsis thaliana


Alignment Length:220 Identity:46/220 - (20%)
Similarity:76/220 - (34%) Gaps:66/220 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 SEMSKTYQYRKVMKP------------MLERKRRARINKCLDELKDLMVATLESEGEHVTRLEKA 59
            |:.:||..:.:..||            :.|||||...||.:..|:||:        .:..:.:||
plant   209 SDDAKTQVHARTRKPVTKRKRSTEVHKLYERKRRDEFNKKMRALQDLL--------PNCYKDDKA 265

  Fly    60 DILELTVTHLQKMKQQRQHKRASGDESLTPAE------------GFRSGYIHAVNEVSRSL---- 108
            .:|:..:.:::.::.|.| ..:.|:..:.|..            |...|.......:.:.|    
plant   266 SLLDEAIKYMRTLQLQVQ-MMSMGNGLIRPPTMLPMGHYSPMGLGMHMGAAATPTSIPQFLPMNV 329

  Fly   109 --SQLPGMNVSLGTQLMTHLGQRLNQI------QPAEKEVLPVTAPLSVHIANRDAYSVPISPIS 165
              :..|||| :...|:::.|......|      .|.|....|...|..|  :...|.|....|.|
plant   330 QATGFPGMN-NAPPQMLSFLNHPSGLIPNTPIFSPLENCSQPFVVPSCV--SQTQATSFTQFPKS 391

  Fly   166 ------------------SYAGSPN 172
                              ||..|||
plant   392 ASASNLEDAMQYRGSNGFSYYRSPN 416

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)mgamma-HLHNP_524504.2 HLH 15..77 CDD:238036 16/73 (22%)
ORANGE 91..135 CDD:128787 10/67 (15%)
PIL1NP_182220.2 bHLH_AtPIF_like 229..292 CDD:381451 16/71 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.