Sequence 1: | NP_524504.2 | Gene: | E(spl)mgamma-HLH / 43151 | FlyBaseID: | FBgn0002735 | Length: | 205 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_110389.1 | Gene: | BHLHE41 / 79365 | HGNCID: | 16617 | Length: | 482 | Species: | Homo sapiens |
Alignment Length: | 196 | Identity: | 52/196 - (26%) |
---|---|---|---|
Similarity: | 90/196 - (45%) | Gaps: | 42/196 - (21%) |
- Green bases have known domain annotations that are detailed below.
Fly 3 SLQMSEMSKTYQYRKVMKPMLERKRRARINKCLDELKDLMVATLESEGEHVT-----RLEKADIL 62
Fly 63 ELTVTHLQKMK--QQRQHKR----ASGDESL-----TPAEGFRSGYIHAVNEVSRSLSQLPGMNV 116
Fly 117 SLGTQLMTHLGQRLNQIQPAEKEVLPVTAPLSVHIANRDAYSVPISPISSYAGSPNSNTSSTSHS 181
Fly 182 L 182 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
E(spl)mgamma-HLH | NP_524504.2 | HLH | 15..77 | CDD:238036 | 25/68 (37%) |
ORANGE | 91..135 | CDD:128787 | 10/43 (23%) | ||
BHLHE41 | NP_110389.1 | bHLH-O_DEC2 | 31..122 | CDD:381593 | 33/96 (34%) |
Necessary for interaction with RXRA and repressor activity towards RXRA. /evidence=ECO:0000269|PubMed:19786558 | 67..71 | 3/3 (100%) | |||
ORANGE | 129..175 | CDD:128787 | 10/50 (20%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 228..298 | ||||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 438..482 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C165140895 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG4304 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR10985 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
4 | 3.840 |