DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)mgamma-HLH and Bhlhe41

DIOPT Version :9

Sequence 1:NP_524504.2 Gene:E(spl)mgamma-HLH / 43151 FlyBaseID:FBgn0002735 Length:205 Species:Drosophila melanogaster
Sequence 2:NP_077789.1 Gene:Bhlhe41 / 79362 MGIID:1930704 Length:410 Species:Mus musculus


Alignment Length:205 Identity:58/205 - (28%)
Similarity:94/205 - (45%) Gaps:41/205 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SLQMSEMSKTYQYRKVMKPMLERKRRARINKCLDELKDLMVATLESEGEHVT-----RLEKADIL 62
            ||:..:...||   |:...::|:|||.|||:|:.:||||:       .||:.     .||||.:|
Mouse    35 SLKRDDTKDTY---KLPHRLIEKKRRDRINECIAQLKDLL-------PEHLKLTTLGHLEKAVVL 89

  Fly    63 ELTVTHLQKMK--QQRQHKR----ASGDESL-TPA----EGFRSGYIHAVNEVSRSLSQLPGM-- 114
            |||:.||:.:.  .::||::    .:|:.|| :|.    :.|.||:.....||.:.|::....  
Mouse    90 ELTLKHLKALTALTEQQHQKIIALQNGERSLKSPVQADLDAFHSGFQTCAKEVLQYLARFESWTP 154

  Fly   115 NVSLGTQLMTHLGQRLNQIQPAEKEVLPV-----TAPLSVHIA-----NRDAYSVPISPISSYAG 169
            ......||::||.....|:...:   :|.     .||.|...|     .|.|..||:...:....
Mouse   155 REPRCAQLVSHLHAVATQLLTPQ---VPSGRGSGRAPCSAGAAAASGPERVARCVPVIQRTQPGT 216

  Fly   170 SPNSNTSSTS 179
            .|..:|.:.|
Mouse   217 EPEHDTDTDS 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)mgamma-HLHNP_524504.2 HLH 15..77 CDD:238036 25/68 (37%)
ORANGE 91..135 CDD:128787 11/45 (24%)
Bhlhe41NP_077789.1 bHLH-O_DEC2 31..122 CDD:381593 34/96 (35%)
ORANGE 129..175 CDD:128787 11/45 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 209..255 3/18 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 360..410
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167830858
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10985
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.