DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)mgamma-HLH and hes6.2

DIOPT Version :9

Sequence 1:NP_524504.2 Gene:E(spl)mgamma-HLH / 43151 FlyBaseID:FBgn0002735 Length:205 Species:Drosophila melanogaster
Sequence 2:NP_001072210.1 Gene:hes6.2 / 779656 XenbaseID:XB-GENE-479404 Length:189 Species:Xenopus tropicalis


Alignment Length:223 Identity:66/223 - (29%)
Similarity:107/223 - (47%) Gaps:52/223 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSSLQMSEMS--KTYQYRKVMKPMLERKRRARINKCLDELKDLMVATLESEGEHVTRLEKADILE 63
            ||....|::.  ...:.||:.||::|||||.|||.||::||:.::.....:   .::||||||||
 Frog     1 MSGAGRSQLKACSAKEERKLRKPLIERKRRERINTCLEQLKETVIKAFHLD---QSKLEKADILE 62

  Fly    64 LTVTHLQKMKQQRQHKRASGDESLTPAEG-------FRSGYIHAVNEVSRSLSQLPGMNVSLGTQ 121
            :||.|||.:    |..:::|:    |::|       |.:|||..::|:...|.....|:.:||.:
 Frog    63 MTVRHLQNI----QKSKSTGE----PSQGSVDAQQRFSTGYIQCMHELHSLLLTCDWMDPALGAR 119

  Fly   122 LMTHL--------GQRLNQIQPAEKEVLPVTAPLSVHIANRDAYSVPI-SPISSYAGSPNSNTSS 177
            |:.||        |:....||..|.:.....:| |:.....:..|||: |.::.         ..
 Frog   120 LLNHLLKSLPRPEGRTAFLIQDYEGDTGRTMSP-SLSDCEAEQTSVPLHSDVAQ---------GK 174

  Fly   178 TSHSLLTTIDVTKMEDDSEDEENVWRPW 205
            |..|||.::             .:||||
 Frog   175 TQCSLLRSL-------------QMWRPW 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)mgamma-HLHNP_524504.2 HLH 15..77 CDD:238036 29/61 (48%)
ORANGE 91..135 CDD:128787 15/58 (26%)
hes6.2NP_001072210.1 bHLH_O_HES 25..75 CDD:381416 26/56 (46%)
Hairy_orange 91..129 CDD:369405 12/37 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 88 1.000 Inparanoid score I4979
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1483774at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.060

Return to query results.
Submit another query.