DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)mgamma-HLH and bhlhe40

DIOPT Version :9

Sequence 1:NP_524504.2 Gene:E(spl)mgamma-HLH / 43151 FlyBaseID:FBgn0002735 Length:205 Species:Drosophila melanogaster
Sequence 2:XP_004914192.2 Gene:bhlhe40 / 779502 XenbaseID:XB-GENE-486416 Length:385 Species:Xenopus tropicalis


Alignment Length:214 Identity:60/214 - (28%)
Similarity:94/214 - (43%) Gaps:58/214 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSSLQMSEMSKTYQYRKVMK--------------PMLERKRRARINKCLDELKDLMVATLESEGE 51
            :|.:..|.|...:::||.:|              .::|:|||.|||:|:.:||||:       .|
 Frog    46 LSGMDFSHMYPVFKHRKALKRCEESKQDTYKLPHRLIEKKRRDRINECIAQLKDLL-------PE 103

  Fly    52 HVT-----RLEKADILELTVTHLQKM----KQQRQH--KRASGDES----LTPAEGFRSGYIHAV 101
            |:.     .||||.:||||:.|::.:    :||:|.  ...||..|    ::..|.|.||:....
 Frog   104 HLKLTTLGHLEKAVVLELTLKHVRSLSSLIEQQQQQILTLQSGSPSEENRISAEEMFHSGFQLCA 168

  Fly   102 NEVSRSLSQLPGMNVSLG---TQLMTHLGQRLNQIQPA------EKEVLPVTAPLSVHIANRDAY 157
            .|..|.|.         |   .:|:.||.:..:::.||      ||.|..|.|...|.:..|.| 
 Frog   169 EEALRFLQ---------GGERKELVAHLHRVASKLGPASFPKVTEKPVPKVQATNCVPVICRAA- 223

  Fly   158 SVPISPISSYAGSPNSNTS 176
              |: |....:|:.....|
 Frog   224 --PL-PSGEQSGTDTDTDS 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)mgamma-HLHNP_524504.2 HLH 15..77 CDD:238036 28/84 (33%)
ORANGE 91..135 CDD:128787 11/46 (24%)
bhlhe40XP_004914192.2 bHLH_SF 61..151 CDD:412148 32/96 (33%)
Hairy_orange 160..192 CDD:400076 10/40 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10985
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.