DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)mgamma-HLH and hes5.10

DIOPT Version :9

Sequence 1:NP_524504.2 Gene:E(spl)mgamma-HLH / 43151 FlyBaseID:FBgn0002735 Length:205 Species:Drosophila melanogaster
Sequence 2:NP_001039178.1 Gene:hes5.10 / 734014 XenbaseID:XB-GENE-876529 Length:166 Species:Xenopus tropicalis


Alignment Length:201 Identity:49/201 - (24%)
Similarity:84/201 - (41%) Gaps:55/201 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 QMSEMSKTYQYRKVMKPMLERKRRARINKCLDELKDLMVATLESEGEHVTRLEKADILELTVTHL 69
            |::::.|    .|:.||::|:.||.|||..:::|:.|:....::...| ::||||||||:.|::|
 Frog    15 QLNDLKK----NKIRKPVIEKMRRDRINHSIEQLRILLERNFQTHHPH-SKLEKADILEMAVSYL 74

  Fly    70 QKMKQQRQHKRASGDESLTPAEGFRSGYIHAVNEVSRSLSQLPGMNVSLGTQLMTHLGQRLNQIQ 134
            |:.|:.:.::.....|::  .:.:..||...:.|....|.          ||...|: |..|:..
 Frog    75 QQQKKHQMNRSHLLPENV--QDSYYQGYYMCLKETVGFLH----------TQENGHI-QEENKNL 126

  Fly   135 PAEKEVLPVTAPLSVHIANRDAYSVPISPISSYAGSPNSNTSSTSHSLLTTIDVTKMEDDSEDEE 199
            ......||  ||.......|  .|:.:||.|.                                 
 Frog   127 TWNDSCLP--APYQSLYQQR--VSLQVSPGSM--------------------------------- 154

  Fly   200 NVWRPW 205
            .:||||
 Frog   155 KIWRPW 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)mgamma-HLHNP_524504.2 HLH 15..77 CDD:238036 24/61 (39%)
ORANGE 91..135 CDD:128787 9/43 (21%)
hes5.10NP_001039178.1 bHLH-O_HES5 23..81 CDD:381467 24/58 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1011
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.