DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)mgamma-HLH and hes5.2

DIOPT Version :9

Sequence 1:NP_524504.2 Gene:E(spl)mgamma-HLH / 43151 FlyBaseID:FBgn0002735 Length:205 Species:Drosophila melanogaster
Sequence 2:NP_001037974.1 Gene:hes5.2 / 733755 XenbaseID:XB-GENE-876635 Length:158 Species:Xenopus tropicalis


Alignment Length:197 Identity:55/197 - (27%)
Similarity:84/197 - (42%) Gaps:66/197 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 KVMKPMLERKRRARINKCLDELKDLMVATLESEGEHVTRLEKADILELTVTHLQ----KMKQQRQ 77
            |:.||::|:.||.|||..:::||.|:......:..:| :||||||||:|||:|:    ::|.:..
 Frog    20 KLRKPVVEKMRRDRINSSIEQLKGLLETVFHKQQPNV-KLEKADILEMTVTYLRQQTLQIKSEIP 83

  Fly    78 HKRASGDESLTPAEGFRSGYIHAVNEVSRSLSQLPGMNVSLGTQLMTHLGQRLNQIQPAEKEVLP 142
            |   :.|..:    .::.||.....||...||                    |:|.||.      
 Frog    84 H---NNDIQM----DYKDGYSRCFEEVIDFLS--------------------LHQKQPE------ 115

  Fly   143 VTAPLSVHIANRDAYSVPISPISSY----AGSPNSNTSSTSHSLLTTIDVTKMEDDSEDEENVWR 203
             ||.|..|..::    ...|.|||:    :.|..:|.:.:|.||                   ||
 Frog   116 -TAKLISHFHSK----ATASSISSFPIRCSQSKTANGTGSSSSL-------------------WR 156

  Fly   204 PW 205
            ||
 Frog   157 PW 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)mgamma-HLHNP_524504.2 HLH 15..77 CDD:238036 26/63 (41%)
ORANGE 91..135 CDD:128787 8/43 (19%)
hes5.2NP_001037974.1 bHLH-O_HES5 20..77 CDD:381467 25/57 (44%)
ORANGE 90..128 CDD:128787 14/72 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1011
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.