DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)mgamma-HLH and hes5.1

DIOPT Version :9

Sequence 1:NP_524504.2 Gene:E(spl)mgamma-HLH / 43151 FlyBaseID:FBgn0002735 Length:205 Species:Drosophila melanogaster
Sequence 2:NP_001037880.1 Gene:hes5.1 / 733463 XenbaseID:XB-GENE-481135 Length:154 Species:Xenopus tropicalis


Alignment Length:192 Identity:50/192 - (26%)
Similarity:81/192 - (42%) Gaps:58/192 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 KVMKPMLERKRRARINKCLDELKDLMVATLESEGEHVTRLEKADILELTVTHLQKMKQQRQHKRA 81
            |:.||::|:.||.|||..:::||.|:......:..:| :||||||||:.|::||:.|.|      
 Frog    18 KLRKPIVEKMRRDRINNSIEQLKALLEKEFHKQEPNV-KLEKADILEMAVSYLQQQKSQ------ 75

  Fly    82 SGDESLTPAE-GFRSGYIHAVNEVSRSLSQLPGMNVSLGTQ--LMTHLGQRLNQIQPAEKEVLPV 143
              ..:|...| .::.|:...:.|..:.|...|   .|..||  |:.||                 
 Frog    76 --SPNLAKLEQDYKQGFSSCLREAVQFLCYYP---ESGETQMKLLKHL----------------- 118

  Fly   144 TAPLSVHIANRDAYSVPISPISSYAGSPNSNTSSTSHSLLTTIDVTKMEDDSEDEENVWRPW 205
            .||..:.:|       |::.|.|.:.|..:..:|                   :...:||||
 Frog   119 QAPQKLSVA-------PLTYIPSVSDSKQAALAS-------------------NPSKIWRPW 154

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)mgamma-HLHNP_524504.2 HLH 15..77 CDD:238036 26/59 (44%)
ORANGE 91..135 CDD:128787 11/46 (24%)
hes5.1NP_001037880.1 HLH 14..75 CDD:238036 25/57 (44%)
Hairy_orange 84..121 CDD:295407 10/56 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1011
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.