DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)mgamma-HLH and Hes3

DIOPT Version :9

Sequence 1:NP_524504.2 Gene:E(spl)mgamma-HLH / 43151 FlyBaseID:FBgn0002735 Length:205 Species:Drosophila melanogaster
Sequence 2:NP_073178.1 Gene:Hes3 / 64628 RGDID:621339 Length:175 Species:Rattus norvegicus


Alignment Length:214 Identity:58/214 - (27%)
Similarity:82/214 - (38%) Gaps:70/214 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 LERKRRARINKCLDELKDLMVATLESEGEHVTR---LEKADILELTVTHLQKMKQQRQHKRASGD 84
            :|:|||||||..|::|:.|    ||....|..|   |||||||||:|.:::.::...|      .
  Rat     1 MEKKRRARINLSLEQLRSL----LERHYSHQIRKRKLEKADILELSVKYVRSLQNSLQ------G 55

  Fly    85 ESLTPA-----EGFRSGYIHAVNEVSRSLSQLPGMNVSLGTQLMTHLGQRLNQIQPAEKE----- 139
            ..|.|:     .|||.|              |||.:            |||   :|.|.:     
  Rat    56 LWLVPSGVDYPSGFRGG--------------LPGSS------------QRL---RPGEDDSGLRC 91

  Fly   140 --VLPVTAPLSVHIANRDAYSV--PISPISSYAGSPNSNTSS-------------TSHSLLTTID 187
              :|...|..:...||....||  |..|.....|.|...:.|             :|..:|....
  Rat    92 PLLLQRRAGSTTDSANPQTASVLSPCLPAIWAPGPPAGGSQSPQSPFPPLGGLLESSTGILAPPP 156

  Fly   188 VTKME-DDSEDEENVWRPW 205
            .:..: ::......|||||
  Rat   157 ASNCQAENPRPGFRVWRPW 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)mgamma-HLHNP_524504.2 HLH 15..77 CDD:238036 25/56 (45%)
ORANGE 91..135 CDD:128787 10/43 (23%)
Hes3NP_073178.1 bHLH-O_HES3 1..55 CDD:381503 26/63 (41%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 124..175 8/50 (16%)
WRPW motif 172..175 2/2 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166334558
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10985
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.