DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)mgamma-HLH and her7

DIOPT Version :9

Sequence 1:NP_524504.2 Gene:E(spl)mgamma-HLH / 43151 FlyBaseID:FBgn0002735 Length:205 Species:Drosophila melanogaster
Sequence 2:XP_021331987.1 Gene:her7 / 58132 ZFINID:ZDB-GENE-000427-6 Length:221 Species:Danio rerio


Alignment Length:216 Identity:65/216 - (30%)
Similarity:94/216 - (43%) Gaps:46/216 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 QYRKVMKPMLERKRRARINKCLDELKDLMVATLESEGEHVTRLEKADILELTVTHLQKMKQQRQH 78
            ::.|::||.:||:||.|:|:.|:.||.|::...|....:..|||||:|||.||..||  |..:..
Zfish    27 RFLKLLKPQVERRRRERMNRSLENLKLLLLQGPEHNQPNQRRLEKAEILEYTVLFLQ--KANKAS 89

  Fly    79 KRASGDESLTPAEGFRSGYIHAVNEVSRSLSQ---LPGMNVSLGTQLMTHLGQRL-----NQIQP 135
            |...|:|.....|||.|    .:.:.:|.|.:   |.|...|:..|.:.|...||     ::.|.
Zfish    90 KEEEGEEKSQFMEGFSS----CLQKAARFLLEEGGLEGSVTSMLCQRLAHPTIRLPVRGHSRKQH 150

  Fly   136 AEKEVLPVTAPLSVHIANRDAYSVPISPISSYAGSPN----------------SNTSSTSHSLLT 184
            ||..        ..|.|.|..:...:|.    ||.|:                |..|:|.||   
Zfish   151 AESN--------PQHHARRPHHKNTVSK----AGHPSACRNTKEPQASRAAFRSTDSNTKHS--- 200

  Fly   185 TIDVTKMEDDSEDEENVWRPW 205
            |...|....:.. .:.|||||
Zfish   201 TAQPTSRHPEPA-SQTVWRPW 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)mgamma-HLHNP_524504.2 HLH 15..77 CDD:238036 27/61 (44%)
ORANGE 91..135 CDD:128787 13/51 (25%)
her7XP_021331987.1 Hairy_orange 100..135 CDD:311465 10/38 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170573662
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.