Sequence 1: | NP_524504.2 | Gene: | E(spl)mgamma-HLH / 43151 | FlyBaseID: | FBgn0002735 | Length: | 205 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_997726.1 | Gene: | hey1 / 58008 | ZFINID: | ZDB-GENE-000607-70 | Length: | 317 | Species: | Danio rerio |
Alignment Length: | 205 | Identity: | 57/205 - (27%) |
---|---|---|---|
Similarity: | 98/205 - (47%) | Gaps: | 43/205 - (20%) |
- Green bases have known domain annotations that are detailed below.
Fly 1 MSSLQMSEMSKTYQYRKVMKPMLERKRRARINKCLDELKDLMVATLESEGEHVTRLEKADILELT 65
Fly 66 VTHLQKMKQQRQHKRASGDESLTPAEG----FRS-GYIHAVNEVSRSLSQLPGMNVS--LGTQLM 123
Fly 124 THLGQRLNQIQPAEKEVLPVTAPLSVHIANRDAYSVPISPIS-----------------SYAGSP 171
Fly 172 NSNTSSTSHS 181 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
E(spl)mgamma-HLH | NP_524504.2 | HLH | 15..77 | CDD:238036 | 24/61 (39%) |
ORANGE | 91..135 | CDD:128787 | 12/50 (24%) | ||
hey1 | NP_997726.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..59 | 7/24 (29%) | |
HLH | 49..106 | CDD:238036 | 24/65 (37%) | ||
ORANGE | 119..165 | CDD:128787 | 12/46 (26%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 193..264 | 8/28 (29%) | |||
YRPW motif | 307..310 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C170573630 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG4304 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.740 |