DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)mgamma-HLH and her8.2

DIOPT Version :9

Sequence 1:NP_524504.2 Gene:E(spl)mgamma-HLH / 43151 FlyBaseID:FBgn0002735 Length:205 Species:Drosophila melanogaster
Sequence 2:NP_001159638.1 Gene:her8.2 / 565269 ZFINID:ZDB-GENE-060815-4 Length:211 Species:Danio rerio


Alignment Length:223 Identity:78/223 - (34%)
Similarity:111/223 - (49%) Gaps:41/223 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SSLQMSEMSKTYQYRKVMKPMLERKRRARINKCLDELKDLMVATLESEGEHVTRLEKADILELTV 66
            :|.|:...||  :.||:.||::|||||.|||.|||:|::.:||..:.:   .::||||||||:||
Zfish    11 NSCQLHISSK--EERKLRKPLIERKRRERINLCLDQLRETVVAVFKPD---QSKLEKADILEMTV 70

  Fly    67 THLQKMKQQRQHKRASGDESLTPA-EGFRSGYIHAVNEVSRSLSQLPGMNVSLGTQLMTHLGQRL 130
            .|||.:    |..|.|.....|.| :.:.:|||..:.||...|.....|:.:||::|:.||.:.|
Zfish    71 KHLQNI----QSSRVSDPVLNTGARQRYSTGYIQCMQEVHNLLHSCDWMDKTLGSRLLNHLFKSL 131

  Fly   131 NQIQPAEKEVLPVTAPLSV----------HIANRDAYSVPISPISSYAGSP----NSNTSSTSHS 181
             .:...:...||.|:..||          |:   |..:.| .|.||   ||    ..|.|...| 
Zfish   132 -PLSAKDCPRLPKTSLTSVPSDHSEYSSFHV---DETASP-KPCSS---SPFLCKRPNQSQNQH- 187

  Fly   182 LLTTIDVTKMEDDSEDEE----NVWRPW 205
             .|.|   :|..|.|...    .:||||
Zfish   188 -FTPI---RMPHDVESSHLSVLQMWRPW 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)mgamma-HLHNP_524504.2 HLH 15..77 CDD:238036 31/61 (51%)
ORANGE 91..135 CDD:128787 13/43 (30%)
her8.2NP_001159638.1 HLH 20..77 CDD:238036 32/65 (49%)
Hairy_orange 94..132 CDD:284859 13/38 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170573650
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 92 1.000 Inparanoid score I5073
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1483774at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10985
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
87.860

Return to query results.
Submit another query.