DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)mgamma-HLH and bhlhe41

DIOPT Version :9

Sequence 1:NP_524504.2 Gene:E(spl)mgamma-HLH / 43151 FlyBaseID:FBgn0002735 Length:205 Species:Drosophila melanogaster
Sequence 2:NP_001034196.1 Gene:bhlhe41 / 563771 ZFINID:ZDB-GENE-050419-146 Length:421 Species:Danio rerio


Alignment Length:180 Identity:55/180 - (30%)
Similarity:85/180 - (47%) Gaps:40/180 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SSLQMSEMSKTYQYR-------KVMKPMLERKRRARINKCLDELKDLMVATLESEGEHVT----- 54
            |||.|.: ||....|       |:...::|:|||.|||:|:.:||||:       .||:.     
Zfish    25 SSLYMCK-SKRGMKREEGKDAYKLPHRLIEKKRRDRINECIGQLKDLL-------PEHLKLTTLG 81

  Fly    55 RLEKADILELTVTHLQKMK--QQRQHKR----ASGDESLTPA-----EGFRSGYIHAVNEVSRSL 108
            .||||.:||||:.||..:.  .::||::    .:|:.||..:     :.|.||:.....||.:.|
Zfish    82 HLEKAVVLELTLKHLNALTAVTEQQHQKIIALQNGERSLKSSLQADLDAFHSGFQACAKEVLQYL 146

  Fly   109 SQLPGMNV--SLGTQLMTHLGQRLNQIQPAEKEVLPVTAPLSVHIANRDA 156
            :::.....  ...|:|:.||.:...|.||.       |..|...:|..||
Zfish   147 NKVENWTAREQRCTRLINHLHKVSAQFQPG-------TGILQQPVAGDDA 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)mgamma-HLHNP_524504.2 HLH 15..77 CDD:238036 26/75 (35%)
ORANGE 91..135 CDD:128787 11/45 (24%)
bhlhe41NP_001034196.1 HLH 46..99 CDD:238036 25/59 (42%)
Hairy_orange 131..171 CDD:284859 10/39 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170573702
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10985
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.