DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)mgamma-HLH and Heyl

DIOPT Version :9

Sequence 1:NP_524504.2 Gene:E(spl)mgamma-HLH / 43151 FlyBaseID:FBgn0002735 Length:205 Species:Drosophila melanogaster
Sequence 2:NP_038933.2 Gene:Heyl / 56198 MGIID:1860511 Length:326 Species:Mus musculus


Alignment Length:189 Identity:55/189 - (29%)
Similarity:88/189 - (46%) Gaps:42/189 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 MSEMSK--------TYQYRKVMKPMLERKRRARINKCLDELKDLMVATLESEGEHVTRLEKADIL 62
            :|:|::        ..|.||..:.::|::||.|||..|.||:.|:....|.:|.  ::||||::|
Mouse    26 LSQMARPLTTPSPSQMQARKKRRGIIEKRRRDRINSSLSELRRLVPTAFEKQGS--SKLEKAEVL 88

  Fly    63 ELTVTHLQKMKQQRQHKRASGDESLTPAEG----FRS-GYIHAVNEVSRSLSQLPGMNV---SLG 119
            ::||.||:.:       .|||......|..    ||| |:...:.||.|.|..|.|.:.   .:.
Mouse    89 QMTVDHLKML-------HASGGTGFFDARALAVDFRSIGFRECLTEVIRYLGVLEGPSSHADPVR 146

  Fly   120 TQLMTHLGQRLNQIQPAEKEVLPVTAPLSVHIANRDAYSVPISP---ISSYAGSPNSNT 175
            .:|::||     :...||.|..|.|.         .|.:.|:.|   :.|..|.|:.|:
Mouse   147 IRLLSHL-----KSYAAEMEPSPTTT---------SALAFPVWPWSFLHSCPGLPSLNS 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)mgamma-HLHNP_524504.2 HLH 15..77 CDD:238036 23/61 (38%)
ORANGE 91..135 CDD:128787 13/51 (25%)
HeylNP_038933.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..56 6/29 (21%)
Transcriptional repression and interaction with NCOR1 and SIN3A. /evidence=ECO:0000250 42..111 28/77 (36%)
HLH 44..100 CDD:238036 23/64 (36%)
ORANGE 115..162 CDD:128787 15/51 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 223..260
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 272..306
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167830882
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.