DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)mgamma-HLH and usp10

DIOPT Version :9

Sequence 1:NP_524504.2 Gene:E(spl)mgamma-HLH / 43151 FlyBaseID:FBgn0002735 Length:205 Species:Drosophila melanogaster
Sequence 2:NP_001006761.1 Gene:usp10 / 448441 XenbaseID:XB-GENE-966184 Length:805 Species:Xenopus tropicalis


Alignment Length:247 Identity:49/247 - (19%)
Similarity:86/247 - (34%) Gaps:79/247 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSSLQMSEMSKTYQYRKVMKPMLERKRRARINKCLDELK------DLMVATLESEGE--HVTRLE 57
            ::|.|::|  |..:.::...|:.|.....:|.:.|:|:|      .|....|.::|.  ::....
 Frog   375 VTSPQVTE--KQVEIKEGPVPVSEDPVAIKIAELLEEVKLVHKPVSLQPRGLINKGNWCYINATL 437

  Fly    58 KADILELTVTHLQK-----MKQQR-------------------------QHKRASGDE---SLTP 89
            :|.:....:.||.|     .|.||                         :.|:|||::   .:.|
 Frog   438 QALVACPPMYHLMKSIPVYTKAQRPCTSTPMIDSFVRLMNEFTNMPILPKAKQASGEKVIRDIRP 502

  Fly    90 AEGFRSGYIHAVNEVSRSLSQLPGMNVSLGTQLMTHLGQRLN----QIQPAEKEVLPVTAPLSVH 150
            ...|...||:.:..|.:|.....|..    .....:||..||    ::...:|.:||...  .:|
 Frog   503 GAPFEPAYIYRLLTVFKSSLSEKGRQ----EDAEEYLGFILNGLHEEMLSLKKLLLPQND--KIH 561

  Fly   151 IANRDAYSVPISPISSYAGSPNSNTSSTSHSLLTTIDVTKMEDDSEDEENVW 202
            |.|..      .|:|...                  ::.|.|.:..|||  |
 Frog   562 INNGP------DPVSEKE------------------EINKDEQEGSDEE--W 587

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)mgamma-HLHNP_524504.2 HLH 15..77 CDD:238036 16/99 (16%)
ORANGE 91..135 CDD:128787 10/47 (21%)
usp10NP_001006761.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 139..170
UCH 422..799 CDD:306860 38/198 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 561..593 11/53 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165161042
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.