Sequence 1: | NP_524504.2 | Gene: | E(spl)mgamma-HLH / 43151 | FlyBaseID: | FBgn0002735 | Length: | 205 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001006761.1 | Gene: | usp10 / 448441 | XenbaseID: | XB-GENE-966184 | Length: | 805 | Species: | Xenopus tropicalis |
Alignment Length: | 247 | Identity: | 49/247 - (19%) |
---|---|---|---|
Similarity: | 86/247 - (34%) | Gaps: | 79/247 - (31%) |
- Green bases have known domain annotations that are detailed below.
Fly 1 MSSLQMSEMSKTYQYRKVMKPMLERKRRARINKCLDELK------DLMVATLESEGE--HVTRLE 57
Fly 58 KADILELTVTHLQK-----MKQQR-------------------------QHKRASGDE---SLTP 89
Fly 90 AEGFRSGYIHAVNEVSRSLSQLPGMNVSLGTQLMTHLGQRLN----QIQPAEKEVLPVTAPLSVH 150
Fly 151 IANRDAYSVPISPISSYAGSPNSNTSSTSHSLLTTIDVTKMEDDSEDEENVW 202 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
E(spl)mgamma-HLH | NP_524504.2 | HLH | 15..77 | CDD:238036 | 16/99 (16%) |
ORANGE | 91..135 | CDD:128787 | 10/47 (21%) | ||
usp10 | NP_001006761.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 139..170 | ||
UCH | 422..799 | CDD:306860 | 38/198 (19%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 561..593 | 11/53 (21%) | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C165161042 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.930 |