DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)mgamma-HLH and cwo

DIOPT Version :9

Sequence 1:NP_524504.2 Gene:E(spl)mgamma-HLH / 43151 FlyBaseID:FBgn0002735 Length:205 Species:Drosophila melanogaster
Sequence 2:NP_524775.1 Gene:cwo / 44669 FlyBaseID:FBgn0259938 Length:698 Species:Drosophila melanogaster


Alignment Length:207 Identity:43/207 - (20%)
Similarity:91/207 - (43%) Gaps:48/207 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 SKTYQYRKVMKPMLERKRRARINKCLDELKDLMVATLESEGEHVTRLEKADILELTVTHLQKMKQ 74
            :||.:...:...::|::||.|:|.||.:|..|:....:.:|.  .|:||.:|:|:.:.||:.::.
  Fly    57 NKTSRQDPLSHRIIEKRRRDRMNSCLADLSRLIPPQYQRKGR--GRIEKTEIIEMAIRHLKHLQS 119

  Fly    75 QRQHKRASGDESLTPAEGFRSGYIHAVNEVSRSLSQLPGMNVSLGTQLMTHLGQRLNQIQPAEKE 139
            :.|.|.:.          :||||:..:.|.::.|..:         .:.....:.|.::|....|
  Fly   120 ECQQKESD----------YRSGYMDCMKEAAKFLYDV---------HMQDFCHRLLGRLQEHIDE 165

  Fly   140 VLPV---TAPLSVHIANRDAYSVPISPISSYAGSPNS----------NTSSTSHSLLTTIDVTKM 191
            :...   .:..|.|:.:.         :|:.:|||:.          :..:||.|     ||...
  Fly   166 MFKTDCYKSTRSCHMPDN---------VSASSGSPHQAYHPPLCHLRDMLATSAS-----DVEHS 216

  Fly   192 EDDSEDEENVWR 203
            :|.::.::..:|
  Fly   217 QDHNDVKDLSFR 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)mgamma-HLHNP_524504.2 HLH 15..77 CDD:238036 17/61 (28%)
ORANGE 91..135 CDD:128787 7/43 (16%)
cwoNP_524775.1 HLH 66..118 CDD:306515 17/53 (32%)
ORANGE 126..168 CDD:128787 9/60 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438367
Domainoid 1 1.000 45 1.000 Domainoid score I4621
eggNOG 1 0.900 - - E1_KOG4304
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10985
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.