DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)mgamma-HLH and her11

DIOPT Version :9

Sequence 1:NP_524504.2 Gene:E(spl)mgamma-HLH / 43151 FlyBaseID:FBgn0002735 Length:205 Species:Drosophila melanogaster
Sequence 2:NP_001003886.1 Gene:her11 / 445409 ZFINID:ZDB-GENE-040824-4 Length:274 Species:Danio rerio


Alignment Length:274 Identity:70/274 - (25%)
Similarity:112/274 - (40%) Gaps:70/274 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSSLQMSEMSKTYQYRKVMKPMLERKRRARINKCLDELKDLMVATLESEGEHVTRLEKADILELT 65
            |.|.....|:||...::.:||::|:|||.|||..||.|:||:............:||||:||:|.
Zfish     1 MKSTPTFNMTKTEGIKRRLKPVIEKKRRDRINHNLDALRDLLFKNTADTRLQNPKLEKAEILDLA 65

  Fly    66 VTHLQKMKQQRQHKRASGDES---------LTPAEG-FRSGYIHAV-----NEVSRSL--SQLPG 113
            |.:::|..::.:..|.|....         ::||.. :.|.|....     |||..:|  ||...
Zfish    66 VQYIKKTIRKTETARNSNQMDCKSTQNQFVISPAGPLYTSDYCRRFKTSEQNEVLLNLGVSQNLS 130

  Fly   114 MNVSLGTQLMTHLGQRLNQI-QPAEKEVL--PVTAPLSVHIANRDAYSVPISPISSYAGSPNSNT 175
            .:...|.:|::..|..|:.. |...:|:|  |.::.....:. |.:.|..||..|.|:..|:|.|
Zfish   131 GSSKTGNKLVSQKGFLLSPPGQNYHQELLLHPESSLYGSSLL-RQSTSPSISSSSQYSSPPSSPT 194

  Fly   176 -SSTSHS---------------------LLT------------------TIDVT---------KM 191
             :|||.|                     |:|                  |.|:|         :.
Zfish   195 FTSTSCSPSSSPPCPSTSCAAFPDQLSPLITPLSLQRPVFVPQAILPHMTRDLTPPHSPVLALRQ 259

  Fly   192 EDDSEDEENVWRPW 205
            :......::.||||
Zfish   260 DPFPLPNQHAWRPW 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)mgamma-HLHNP_524504.2 HLH 15..77 CDD:238036 23/61 (38%)
ORANGE 91..135 CDD:128787 12/52 (23%)
her11NP_001003886.1 HLH 16..71 CDD:238036 22/54 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170573810
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.