DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)mgamma-HLH and E(spl)m8-HLH

DIOPT Version :9

Sequence 1:NP_524504.2 Gene:E(spl)mgamma-HLH / 43151 FlyBaseID:FBgn0002735 Length:205 Species:Drosophila melanogaster
Sequence 2:NP_524513.1 Gene:E(spl)m8-HLH / 43161 FlyBaseID:FBgn0000591 Length:179 Species:Drosophila melanogaster


Alignment Length:204 Identity:76/204 - (37%)
Similarity:114/204 - (55%) Gaps:29/204 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 MSEMSKTYQYRKVMKPMLERKRRARINKCLDELKDLMVATLESEGEHVTRLEKADILELTVTHLQ 70
            |...:||..|:||.||||||:||||:|||||.||.| ||.|..: :.:.|::||::||..|..  
  Fly     1 MEYTTKTQIYQKVKKPMLERQRRARMNKCLDNLKTL-VAELRGD-DGILRMDKAEMLESAVIF-- 61

  Fly    71 KMKQQRQHKRASGDESLTPAEGFRSGYIHAVNEVSRSLSQLPGMNVSLGTQLMTHLG---QRLNQ 132
             |:||:..|:.:.:|...|.:.|::||::|||||||.::..|||:|.||..:|||||   :.|.|
  Fly    62 -MRQQKTPKKVAQEEQSLPLDSFKNGYMNAVNEVSRVMASTPGMSVDLGKSVMTHLGRVYKNLQQ 125

  Fly   133 IQPAEKEVLPVTAPLSVHIAN-RDAYSVPISPISSYAGSPNSNTSSTSHSLLTTIDVTKMEDDSE 196
            ...|:.        .:..|.| .|..|:..:|:|..:...:|:..|.:.|            ...
  Fly   126 FHEAQS--------AADFIQNSMDCSSMDKAPLSPASSGYHSDCDSPAPS------------PQP 170

  Fly   197 DEENVWRPW 205
            .::.:||||
  Fly   171 MQQPLWRPW 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)mgamma-HLHNP_524504.2 HLH 15..77 CDD:238036 33/61 (54%)
ORANGE 91..135 CDD:128787 23/46 (50%)
E(spl)m8-HLHNP_524513.1 HLH 10..67 CDD:238036 33/61 (54%)
ORANGE 81..125 CDD:128787 22/43 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45469366
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 92 1.000 Inparanoid score I5073
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000785
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10985
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.890

Return to query results.
Submit another query.