DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)mgamma-HLH and E(spl)m3-HLH

DIOPT Version :9

Sequence 1:NP_524504.2 Gene:E(spl)mgamma-HLH / 43151 FlyBaseID:FBgn0002735 Length:205 Species:Drosophila melanogaster
Sequence 2:NP_524509.2 Gene:E(spl)m3-HLH / 43156 FlyBaseID:FBgn0002609 Length:224 Species:Drosophila melanogaster


Alignment Length:242 Identity:97/242 - (40%)
Similarity:132/242 - (54%) Gaps:65/242 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 EMSKTYQYRKVMKPMLERKRRARINKCLDELKDLMVATLESEGEHVTRLEKADILELTVTHLQKM 72
            ||||||||||||||:||||||||||||||:||||||..|:.||||||||||||||||||.|::|:
  Fly     4 EMSKTYQYRKVMKPLLERKRRARINKCLDDLKDLMVECLQQEGEHVTRLEKADILELTVDHMRKL 68

  Fly    73 KQQRQHKRASGDESL--------TP--------AEGFRSGYIHAVNEVSRSLSQLPGMNVSLGTQ 121
            ||:       |..||        :|        .|.|||||:||.:::::.|.|....: .:|.:
  Fly    69 KQR-------GGLSLQGVVAGVGSPPTSTSTAHVESFRSGYVHAADQITQVLLQTQQTD-EIGRK 125

  Fly   122 LMTHLGQRL-----------NQIQPAEKEVLPVTAPLSVHIANRDAYSVPISPISSYAGSPNSNT 175
            :|..|..||           .|.|..:::.:|.:       :.|.|:.:    :..|  .|.:..
  Fly   126 IMKFLSTRLIELQTQLLQQQQQQQQHQQQQIPQS-------SGRLAFPL----LGGY--GPAAAA 177

  Fly   176 SSTSHSLLTT-----IDVTKMEDDSEDE------------ENVWRPW 205
            ::.|:|...|     ||||.::.::..|            |.|||||
  Fly   178 AAISYSSFLTSKDELIDVTSVDGNALSETASVSSQESGASEPVWRPW 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)mgamma-HLHNP_524504.2 HLH 15..77 CDD:238036 50/61 (82%)
ORANGE 91..135 CDD:128787 16/54 (30%)
E(spl)m3-HLHNP_524509.2 HLH 11..70 CDD:238036 48/58 (83%)
ORANGE 96..136 CDD:128787 15/40 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45469349
Domainoid 1 1.000 45 1.000 Domainoid score I4621
eggNOG 1 0.900 - - E1_KOG4304
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 92 1.000 Inparanoid score I5073
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1483774at2759
OrthoFinder 1 1.000 - - FOG0000785
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10985
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1011
98.900

Return to query results.
Submit another query.