DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)mgamma-HLH and her12

DIOPT Version :9

Sequence 1:NP_524504.2 Gene:E(spl)mgamma-HLH / 43151 FlyBaseID:FBgn0002735 Length:205 Species:Drosophila melanogaster
Sequence 2:NP_991182.1 Gene:her12 / 402914 ZFINID:ZDB-GENE-040824-5 Length:155 Species:Danio rerio


Alignment Length:203 Identity:58/203 - (28%)
Similarity:81/203 - (39%) Gaps:62/203 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LQMSEMSKTYQYRKVMKPMLERKRRARINKCLDELKDLMVATLESEGEHVTRLEKADILELTVTH 68
            |..|:..|.    |:.||::|:.||.|||.|:|:||.|:.....|. :..|:||||||||:||:.
Zfish    14 LHFSDKEKI----KLRKPIVEKMRRDRINTCIDQLKSLLEKEFHSH-DPSTKLEKADILEMTVSF 73

  Fly    69 L-QKMKQQRQHKRASGDESLTPAEGFRSGYIHAVNEVSRSLSQLPGMNVSLGTQLMTHLGQRLNQ 132
            | |::|||:|          .|...|..||.|...|....||    ::.:.|.....|.|.:.|.
Zfish    74 LKQQIKQQQQ----------IPQRDFNEGYSHCWRESVHFLS----LHSNAGELQHLHSGPKTNS 124

  Fly   133 IQPAEKEVLPVTAPLSVHIANRDAYSVPISPISSYAGSPNSNTSSTSHSLLTTIDVTKMEDDSED 197
            ...:    .|.||                        ....||::..|              .:.
Zfish   125 TMGS----TPATA------------------------CSKLNTAALQH--------------PDS 147

  Fly   198 EENVWRPW 205
            ...|||||
Zfish   148 VRAVWRPW 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)mgamma-HLHNP_524504.2 HLH 15..77 CDD:238036 31/62 (50%)
ORANGE 91..135 CDD:128787 11/43 (26%)
her12NP_991182.1 HLH 19..74 CDD:238036 27/59 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170573679
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1011
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.