DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)mgamma-HLH and HELT

DIOPT Version :9

Sequence 1:NP_524504.2 Gene:E(spl)mgamma-HLH / 43151 FlyBaseID:FBgn0002735 Length:205 Species:Drosophila melanogaster
Sequence 2:NP_001287710.1 Gene:HELT / 391723 HGNCID:33783 Length:242 Species:Homo sapiens


Alignment Length:111 Identity:36/111 - (32%)
Similarity:54/111 - (48%) Gaps:14/111 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 MSEMSKTYQYRKVMKPMLERKRRARINKCLDELKDL--MVATLESEGEHVTRLEKADILELTVTH 68
            ||:..|..:...|...::|::||.|||:||:||...  |....:|.|    :||||:|||:||.:
Human     1 MSDKLKERKRTPVSHKVIEKRRRDRINRCLNELGKTVPMALAKQSSG----KLEKAEILEMTVQY 61

  Fly    69 LQKMKQQRQHKRASGDESLTP-AEGFRSGY-------IHAVNEVSR 106
            |:.:......:.....|.|.. |..|..||       :|.:..|.|
Human    62 LRALHSADFPRGREKAELLAEFANYFHYGYHECMKNLVHYLTTVER 107

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)mgamma-HLHNP_524504.2 HLH 15..77 CDD:238036 24/63 (38%)
ORANGE 91..135 CDD:128787 6/23 (26%)
HELTNP_001287710.1 bHLH-O_HELT 14..69 CDD:381414 23/58 (40%)
Hairy_orange 87..127 CDD:400076 6/21 (29%)
PRK14951 <133..>207 CDD:237865
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165140871
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.