Sequence 1: | NP_524504.2 | Gene: | E(spl)mgamma-HLH / 43151 | FlyBaseID: | FBgn0002735 | Length: | 205 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001019769.1 | Gene: | HES3 / 390992 | HGNCID: | 26226 | Length: | 186 | Species: | Homo sapiens |
Alignment Length: | 205 | Identity: | 62/205 - (30%) |
---|---|---|---|
Similarity: | 83/205 - (40%) | Gaps: | 49/205 - (23%) |
- Green bases have known domain annotations that are detailed below.
Fly 23 LERKRRARINKCLDELKDLMVATLESEGEHVTR---LEKADILELTVTHLQKMKQQ--------R 76
Fly 77 QHKRASGDESLTP--AEGFRSGYIHAVNEVSRSLSQLPGMNVSLGTQLMTHLGQRLNQIQPA-EK 138
Fly 139 EVLP-VTAPLSVHIANRD-------AYSVPISPISSYAGSPNSNTSSTSHSLLTTIDVTKMEDDS 195
Fly 196 EDEENVWRPW 205 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
E(spl)mgamma-HLH | NP_524504.2 | HLH | 15..77 | CDD:238036 | 26/64 (41%) |
ORANGE | 91..135 | CDD:128787 | 11/43 (26%) | ||
HES3 | NP_001019769.1 | HLH | 1..54 | CDD:238036 | 26/56 (46%) |
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 128..186 | 14/66 (21%) | |||
WRPW motif | 175..178 | 2/2 (100%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C165140887 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG4304 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR10985 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
4 | 3.840 |