DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)mgamma-HLH and HES5

DIOPT Version :9

Sequence 1:NP_524504.2 Gene:E(spl)mgamma-HLH / 43151 FlyBaseID:FBgn0002735 Length:205 Species:Drosophila melanogaster
Sequence 2:XP_005244808.1 Gene:HES5 / 388585 HGNCID:19764 Length:198 Species:Homo sapiens


Alignment Length:232 Identity:55/232 - (23%)
Similarity:89/232 - (38%) Gaps:76/232 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 EMSKTYQYRKVMKPMLERKRRARINKCLDELKDLMVATLESE-GEHV--TRLEKADILELTVTHL 69
            |:....:..::.||::|:.||.|||..:::||.|    ||.| ..|.  ::||||||||:.|::|
Human     9 ELLSPKEKNRLRKPVVEKMRRDRINSSIEQLKLL----LEQEFARHQPNSKLEKADILEMAVSYL 69

  Fly    70 QKMKQQR--------QHK---------------------RASGDESLTPAEGFRSGYIHAVNEVS 105
            :..|.:|        .|:                     .|:|.:||  .:.:..||...:.|..
Human    70 KHSKGERARAPRAPSSHRAPAPPRPAARSPPPRLPAAFVAAAGPKSL--HQDYSEGYSWCLQEAV 132

  Fly   106 RSLSQLPGMNVSLGTQ--LMTHLGQRLNQIQPAEKEVLPVTAPLSVHIANRDAYSVPISPISSYA 168
            :.|:    ::.:..||  |:.|. ||     |......|...|.:...|...|.|...:..::.|
Human   133 QFLT----LHAASDTQMKLLYHF-QR-----PPAAPAAPAKEPKAPGAAPPPALSAKATAAAAAA 187

  Fly   169 GSPNSNTSSTSHSLLTTIDVTKMEDDSEDEENVWRPW 205
            ..|..                          .:||||
Human   188 HQPAC--------------------------GLWRPW 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)mgamma-HLHNP_524504.2 HLH 15..77 CDD:238036 27/72 (38%)
ORANGE 91..135 CDD:128787 10/45 (22%)
HES5XP_005244808.1 HLH 14..71 CDD:238036 25/60 (42%)
Hairy_orange 118..153 CDD:295407 8/39 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165140943
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1011
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.