Sequence 1: | NP_524504.2 | Gene: | E(spl)mgamma-HLH / 43151 | FlyBaseID: | FBgn0002735 | Length: | 205 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_005244808.1 | Gene: | HES5 / 388585 | HGNCID: | 19764 | Length: | 198 | Species: | Homo sapiens |
Alignment Length: | 232 | Identity: | 55/232 - (23%) |
---|---|---|---|
Similarity: | 89/232 - (38%) | Gaps: | 76/232 - (32%) |
- Green bases have known domain annotations that are detailed below.
Fly 8 EMSKTYQYRKVMKPMLERKRRARINKCLDELKDLMVATLESE-GEHV--TRLEKADILELTVTHL 69
Fly 70 QKMKQQR--------QHK---------------------RASGDESLTPAEGFRSGYIHAVNEVS 105
Fly 106 RSLSQLPGMNVSLGTQ--LMTHLGQRLNQIQPAEKEVLPVTAPLSVHIANRDAYSVPISPISSYA 168
Fly 169 GSPNSNTSSTSHSLLTTIDVTKMEDDSEDEENVWRPW 205 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
E(spl)mgamma-HLH | NP_524504.2 | HLH | 15..77 | CDD:238036 | 27/72 (38%) |
ORANGE | 91..135 | CDD:128787 | 10/45 (22%) | ||
HES5 | XP_005244808.1 | HLH | 14..71 | CDD:238036 | 25/60 (42%) |
Hairy_orange | 118..153 | CDD:295407 | 8/39 (21%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C165140943 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 1 | 1.000 | - | - | X1011 | |
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.840 |