DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)mgamma-HLH and hes6

DIOPT Version :9

Sequence 1:NP_524504.2 Gene:E(spl)mgamma-HLH / 43151 FlyBaseID:FBgn0002735 Length:205 Species:Drosophila melanogaster
Sequence 2:NP_919381.2 Gene:hes6 / 373116 ZFINID:ZDB-GENE-030828-5 Length:226 Species:Danio rerio


Alignment Length:226 Identity:58/226 - (25%)
Similarity:107/226 - (47%) Gaps:55/226 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 RKVMKPMLERKRRARINKCLDELKDLMVATLESEGEHVTRLEKADILELTVTHLQKMKQQRQHKR 80
            ||..||::|:|||||||:.|.||: |::|..:::    .::|.|::||:||..::.:.|.:..:.
Zfish    20 RKTRKPLVEKKRRARINESLQELR-LLLADPDAQ----VKMENAEVLEMTVKRVESILQNKAKEA 79

  Fly    81 ASGDESLTPAEGFRSGYIHAVNEVSRSLSQLPGMNVSLGTQLMTHLGQRLNQIQPAEKEVLPVTA 145
            .|.:....  |.|.:|||..::||...:|..||::.::...|:.||           .|.:|:..
Zfish    80 DSVNREAN--ERFAAGYIQCMHEVHTFVSSCPGIDATIAADLLNHL-----------LECMPLND 131

  Fly   146 P------LSVHIANRD---------AYSVPISPISSYAGSPNSNTSSTSHSLLTTIDVTKMEDDS 195
            .      ||..|::.:         ||:. :||..:...:..|:..|.:.|..::.|:....||:
Zfish   132 EERFQDILSDLISDSNNSGTWPGEAAYAT-LSPGGTSVANGGSSALSPAPSTTSSDDICSDLDDT 195

  Fly   196 EDE---------------------ENVWRPW 205
            :.|                     :::||||
Zfish   196 DTEHSRISVDAGDQAPVVPTLYTNKSIWRPW 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)mgamma-HLHNP_524504.2 HLH 15..77 CDD:238036 24/60 (40%)
ORANGE 91..135 CDD:128787 13/43 (30%)
hes6NP_919381.2 HLH 18..75 CDD:238036 24/59 (41%)
Hairy_orange 90..128 CDD:284859 13/48 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170573604
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 92 1.000 Inparanoid score I5073
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1483774at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
76.760

Return to query results.
Submit another query.