DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)mgamma-HLH and her15.2

DIOPT Version :9

Sequence 1:NP_524504.2 Gene:E(spl)mgamma-HLH / 43151 FlyBaseID:FBgn0002735 Length:205 Species:Drosophila melanogaster
Sequence 2:NP_001099062.1 Gene:her15.2 / 359836 ZFINID:ZDB-GENE-070627-1 Length:149 Species:Danio rerio


Alignment Length:207 Identity:56/207 - (27%)
Similarity:83/207 - (40%) Gaps:60/207 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSSLQMSEMSK--TYQYRKVMKPMLERKRRARINKCLDELKDLMVATLESEGEHVTRLEKADILE 63
            |:.:.|:|.||  ..:..|:.||::|:.||.|||.|:::||.::....:.:..: .:||||||||
Zfish     1 MAPVYMTEYSKLSNKEKHKLRKPVVEKMRRDRINNCIEQLKSMLEKEFQQQDPN-AKLEKADILE 64

  Fly    64 LTVTHLQKMKQQRQHKRASGDESLTPAEGFRSGYIHAVNEVSRSLSQLPGMNVSLGTQLMTHLGQ 128
            :||..|   |||.:.|        ||......||.....|....|        |:|::.   :.|
Zfish    65 MTVVFL---KQQLRPK--------TPQNAQIEGYSQCWRETISFL--------SVGSEA---VAQ 107

  Fly   129 RLNQIQPAEKEVLPVTAPLSVHIANRDAYSVPISPISSYAGSPNSNTSSTSHSLLTTIDVTKMED 193
            ||.|      |.....||...|                        ||...|.     ..|.::.
Zfish   108 RLQQ------EARRSAAPELTH------------------------TSEAPHQ-----QHTHIKQ 137

  Fly   194 DSEDEENVWRPW 205
            :......:||||
Zfish   138 EPRAHAPLWRPW 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)mgamma-HLHNP_524504.2 HLH 15..77 CDD:238036 26/61 (43%)
ORANGE 91..135 CDD:128787 10/43 (23%)
her15.2NP_001099062.1 HLH 19..72 CDD:278439 23/56 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170573680
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1011
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.