DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)mgamma-HLH and dpn

DIOPT Version :9

Sequence 1:NP_524504.2 Gene:E(spl)mgamma-HLH / 43151 FlyBaseID:FBgn0002735 Length:205 Species:Drosophila melanogaster
Sequence 2:NP_476923.1 Gene:dpn / 35800 FlyBaseID:FBgn0010109 Length:435 Species:Drosophila melanogaster


Alignment Length:184 Identity:59/184 - (32%)
Similarity:100/184 - (54%) Gaps:21/184 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 MSKTYQYRKVMKPMLERKRRARINKCLDELKDLMVATLESEGEHVTRLEKADILELTVTHLQKMK 73
            :||. :.||..||::|::||||||.||:|||.|::..::.:....|:||||||||:||.|||.::
  Fly    35 LSKA-ELRKTNKPIMEKRRRARINHCLNELKSLILEAMKKDPARHTKLEKADILEMTVKHLQSVQ 98

  Fly    74 QQRQHKRASGDESLTPAEGFRSGYIHAVNEVSRSLSQLPGMNVSLGTQLMTHLGQRLNQIQPA-- 136
            :|:.:.....|.|:  .:.|::|::....||:|.:||:.|::..:..:|..||.|..|.::..  
  Fly    99 RQQLNMAIQSDPSV--VQKFKTGFVECAEEVNRYVSQMDGIDTGVRQRLSAHLNQCANSLEQIGS 161

  Fly   137 --------EKEVLPVTAPLSVHIANRDAYSVPISPISSYAGSPNSNTSSTSHSL 182
                    ...:.|.||.        .|...|:.|......:.||.|.|::.::
  Fly   162 MSNFSNGYRGGLFPATAV--------TAAPTPLFPSLPQDLNNNSRTESSAPAI 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)mgamma-HLHNP_524504.2 HLH 15..77 CDD:238036 32/61 (52%)
ORANGE 91..135 CDD:128787 13/43 (30%)
dpnNP_476923.1 HLH 39..101 CDD:238036 31/61 (51%)
ORANGE 114..158 CDD:128787 13/43 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438350
Domainoid 1 1.000 45 1.000 Domainoid score I4621
eggNOG 1 0.900 - - E1_KOG4304
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000785
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10985
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.840

Return to query results.
Submit another query.