DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)mgamma-HLH and Sidpn

DIOPT Version :9

Sequence 1:NP_524504.2 Gene:E(spl)mgamma-HLH / 43151 FlyBaseID:FBgn0002735 Length:205 Species:Drosophila melanogaster
Sequence 2:NP_523599.1 Gene:Sidpn / 35168 FlyBaseID:FBgn0032741 Length:507 Species:Drosophila melanogaster


Alignment Length:208 Identity:57/208 - (27%)
Similarity:98/208 - (47%) Gaps:59/208 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 RKVMKPMLERKRRARINKCLDELKDLMVATL--------ESEGEHVTRLEKADILELTVTHLQKM 72
            ::..||::|::||||||:.|..||.|::.:.        |.:.:| |:|||||||||||.|.|: 
  Fly    51 KRTNKPLMEKRRRARINQSLAILKALILESTKTQNAKNGEGQAKH-TKLEKADILELTVRHFQR- 113

  Fly    73 KQQRQHKRASGDESLTPAEGFRSGYIHAVNEVSRSLS--QLPGMNVSLGT-----------QLMT 124
                 |:... |.::..   :|:||.....||:|.|:  :.|.|    ||           :|:.
  Fly   114 -----HRNL
D-DPTVNK---YRAGYTDCAREVARYLATPEPPPM----GTMPTLAEPGSKARLLR 165

  Fly   125 HLGQRLNQIQPAEKEVLPVTAPLSVHIANRDAYSVPISPISSYAGSPNSNTS-STSHSLLTTIDV 188
            ||.|.:.:|   :.|:.|.:.                   :::|.||:|::. ..:|...:..:.
  Fly   166 HLDQCIAEI---DVEICPHST-------------------AAFAESPSSSSCFDLNHGKKSQPEE 208

  Fly   189 TKMEDDSEDEENV 201
            ..::..|:|...|
  Fly   209 HSLDYSSQDSNPV 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)mgamma-HLHNP_524504.2 HLH 15..77 CDD:238036 29/68 (43%)
ORANGE 91..135 CDD:128787 16/56 (29%)
SidpnNP_523599.1 HLH 48..117 CDD:238036 30/72 (42%)
Hairy_orange 125..172 CDD:284859 15/50 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438351
Domainoid 1 1.000 65 1.000 Domainoid score I6616
eggNOG 1 0.900 - - E1_KOG4304
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10985
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.