DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)mgamma-HLH and Hesr

DIOPT Version :9

Sequence 1:NP_524504.2 Gene:E(spl)mgamma-HLH / 43151 FlyBaseID:FBgn0002735 Length:205 Species:Drosophila melanogaster
Sequence 2:NP_525094.1 Gene:Hesr / 32800 FlyBaseID:FBgn0030899 Length:149 Species:Drosophila melanogaster


Alignment Length:198 Identity:53/198 - (26%)
Similarity:81/198 - (40%) Gaps:66/198 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 SKTYQYRKVMKPMLERKRRARINKCLDELKDLMVATLESEGEHVTRLEKADILELTVTHLQKMKQ 74
            |:::|||:|.|||:|||||:|||:|||.:|||:......:||.:.:::..|:|||.|.||.|...
  Fly    16 SRSHQYREVFKPMMERKRRSRINRCLDFIKDLLQEVSHLDGETMAKMDMGDVLELAVHHLSKKNC 80

  Fly    75 QRQHKRASGDESL--TPAEGFRSGYIHAVNEVSRSLSQLPGMNVSLGTQLMTHLGQRLNQIQPAE 137
            .......:....:  :|.:.:.||:...|.|||               |.:.|.|.:        
  Fly    81 PVATPTTAPTSGVYQSPIDCYWSGFRECVLEVS---------------QFLQHNGYQ-------- 122

  Fly   138 KEVLPVTAPLSVHIANRDAYSVPISPISSYAGSPNSNTSSTSHSLLTTIDVTKMEDDSEDEENVW 202
                                     |...:|...:...:|||.|                :.|:|
  Fly   123 -------------------------PSFEFAKELDHLVASTSKS----------------KPNLW 146

  Fly   203 RPW 205
            |||
  Fly   147 RPW 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)mgamma-HLHNP_524504.2 HLH 15..77 CDD:238036 30/61 (49%)
ORANGE 91..135 CDD:128787 9/43 (21%)
HesrNP_525094.1 HLH 21..77 CDD:238036 29/55 (53%)
Hairy_orange 101..>116 CDD:295407 7/29 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45469372
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10985
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1011
54.840

Return to query results.
Submit another query.