DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)mgamma-HLH and HES1

DIOPT Version :9

Sequence 1:NP_524504.2 Gene:E(spl)mgamma-HLH / 43151 FlyBaseID:FBgn0002735 Length:205 Species:Drosophila melanogaster
Sequence 2:NP_005515.1 Gene:HES1 / 3280 HGNCID:5192 Length:280 Species:Homo sapiens


Alignment Length:262 Identity:70/262 - (26%)
Similarity:115/262 - (43%) Gaps:86/262 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 QYRKVMKPMLERKRRARINKCLDELKDLMVATLESEGEHVTRLEKADILELTVTHLQKMKQQRQH 78
            ::||..||::|::||||||:.|.:||.|::..|:.:....::||||||||:||.||:.:::.:..
Human    33 EHRKSSKPIMEKRRRARINESLSQLKTLILDALKKDSSRHSKLEKADILEMTVKHLRNLQRAQMT 97

  Fly    79 KRASGDESLTPAEGFRSGYIHAVNEVSRSLSQLPGMNVSLGTQLMTHLGQRLNQI---------Q 134
            ...|.|.|:...  :|:|:...:|||:|.||...|:|..:.|:|:.||...:.||         .
Human    98 AALSTDPSVLGK--YRAGFSECMNEVTRFLSTCEGVNTEVRTRLLGHLANCMTQINAMTYPGQPH 160

  Fly   135 PAEKEVLP-----------------------------------------------------VTAP 146
            ||.:...|                                                     |.||
Human   161 PALQAPPPPPPGPGGPQHAPFAPPPPLVPIPGGAAPPPGGAPCKLGSQAGEAAKVFGGFQVVPAP 225

  Fly   147 ---LSVHIAN-RDAYSVPISPI-SSYAGS---PNSNTSSTSHSLLTTIDVTKMEDDSEDEENVWR 203
               .:..|.| ..|:|.|:.|: :|.:|:   ||:.:.|:..||..              :::||
Human   226 DGQFAFLIPNGAFAHSGPVIPVYTSNSGTSVGPNAVSPSSGPSLTA--------------DSMWR 276

  Fly   204 PW 205
            ||
Human   277 PW 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)mgamma-HLHNP_524504.2 HLH 15..77 CDD:238036 28/61 (46%)
ORANGE 91..135 CDD:128787 16/52 (31%)
HES1NP_005515.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..44 4/10 (40%)
bHLH-O_HES1_4 33..95 CDD:381465 28/61 (46%)
Hairy_orange 110..148 CDD:400076 14/37 (38%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 157..200 3/42 (7%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 254..280 9/39 (23%)
WRPW motif 275..278 2/2 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165140911
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000785
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10985
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.