Sequence 1: | NP_524504.2 | Gene: | E(spl)mgamma-HLH / 43151 | FlyBaseID: | FBgn0002735 | Length: | 205 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_005515.1 | Gene: | HES1 / 3280 | HGNCID: | 5192 | Length: | 280 | Species: | Homo sapiens |
Alignment Length: | 262 | Identity: | 70/262 - (26%) |
---|---|---|---|
Similarity: | 115/262 - (43%) | Gaps: | 86/262 - (32%) |
- Green bases have known domain annotations that are detailed below.
Fly 14 QYRKVMKPMLERKRRARINKCLDELKDLMVATLESEGEHVTRLEKADILELTVTHLQKMKQQRQH 78
Fly 79 KRASGDESLTPAEGFRSGYIHAVNEVSRSLSQLPGMNVSLGTQLMTHLGQRLNQI---------Q 134
Fly 135 PAEKEVLP-----------------------------------------------------VTAP 146
Fly 147 ---LSVHIAN-RDAYSVPISPI-SSYAGS---PNSNTSSTSHSLLTTIDVTKMEDDSEDEENVWR 203
Fly 204 PW 205 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
E(spl)mgamma-HLH | NP_524504.2 | HLH | 15..77 | CDD:238036 | 28/61 (46%) |
ORANGE | 91..135 | CDD:128787 | 16/52 (31%) | ||
HES1 | NP_005515.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..44 | 4/10 (40%) | |
bHLH-O_HES1_4 | 33..95 | CDD:381465 | 28/61 (46%) | ||
Hairy_orange | 110..148 | CDD:400076 | 14/37 (38%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 157..200 | 3/42 (7%) | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 254..280 | 9/39 (23%) | |||
WRPW motif | 275..278 | 2/2 (100%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C165140911 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG4304 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 1 | 1.000 | - | - | FOG0000785 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR10985 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
5 | 4.840 |