DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)mgamma-HLH and bhlhe40

DIOPT Version :9

Sequence 1:NP_524504.2 Gene:E(spl)mgamma-HLH / 43151 FlyBaseID:FBgn0002735 Length:205 Species:Drosophila melanogaster
Sequence 2:NP_997844.2 Gene:bhlhe40 / 324413 ZFINID:ZDB-GENE-030131-3133 Length:403 Species:Danio rerio


Alignment Length:211 Identity:59/211 - (27%)
Similarity:96/211 - (45%) Gaps:47/211 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LQMSEMSK-TYQYRKVMKPMLERKRRARINKCLDELKDLMVATLESEGEHVT-----RLEKADIL 62
            ::.||.|| ||   |:...::|:|||.|||:|:.:||||:       .||:.     .||||.:|
Zfish    40 MKRSEDSKDTY---KLPHRLIEKKRRDRINECIAQLKDLL-------PEHLKLTTLGHLEKAVVL 94

  Fly    63 ELTVTH---LQKMKQQRQHKRAS-------GDESLTPAEG----FRSGYIHAVNEVSRSLSQLPG 113
            |||:.|   |..:.:|:|.|..|       |::...|:|.    ||||:.....||.:.|:....
Zfish    95 ELTLKHVKALNNLLEQQQQKIISLQNGLQIGEQGNGPSENSEEMFRSGFHLCAKEVLQFLANQET 159

  Fly   114 MNVSLGTQLMTHLGQRLNQI----------QPAEKEVLPVTAPLSVHIANRDAYS---VPI---- 161
            |.......::.||.:..:::          :||.|.......|..:.....:.::   ||:    
Zfish   160 MRDLTTAHIIEHLQKVASELIQSPPSPRLDEPASKAQESREKPSGLQPKAAEGHAKNCVPVIQRT 224

  Fly   162 SPISSYAGSPNSNTSS 177
            .|.||.....:::|.|
Zfish   225 YPHSSEQSGSDTDTDS 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)mgamma-HLHNP_524504.2 HLH 15..77 CDD:238036 26/69 (38%)
ORANGE 91..135 CDD:128787 11/57 (19%)
bhlhe40NP_997844.2 HLH 51..109 CDD:238036 25/64 (39%)
Hairy_orange 139..177 CDD:284859 10/37 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170573798
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10985
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.