DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)mgamma-HLH and her8a

DIOPT Version :9

Sequence 1:NP_524504.2 Gene:E(spl)mgamma-HLH / 43151 FlyBaseID:FBgn0002735 Length:205 Species:Drosophila melanogaster
Sequence 2:NP_955918.3 Gene:her8a / 323656 ZFINID:ZDB-GENE-030131-2376 Length:221 Species:Danio rerio


Alignment Length:227 Identity:71/227 - (31%)
Similarity:106/227 - (46%) Gaps:62/227 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 RKVMKPMLERKRRARINKCLDELKDLMVATLESEGEHVTRLEKADILELTVTHLQKMKQQRQHKR 80
            ||:.||::|:|||.|||..|::||.:||   ::.....::|||||:||:||.|::.:  ||.|.:
Zfish    20 RKLRKPLIEKKRRERINSSLEQLKGIMV---DAYNLDQSKLEKADVLEITVQHMENL--QRGHGQ 79

  Fly    81 ASGDESLTPAEGFR------SGYIHAVNEVSRSLSQLPGMNVSLGTQLMTHLGQRLNQI--QPAE 137
            ..   |.:|..||.      ||||..::||...|...|||:.:||.:|:.||.:.|..|  :|:.
Zfish    80 GG---SNSPGTGFESRQRYSSGYIQCMHEVHNLLLSCPGMDKTLGARLLNHLLKSLPHISTEPSG 141

  Fly   138 KEVLPVTAPLSVHIANRDAYSVPISPISSYAGSPN-----------SNTSSTSHSLLTTIDVTKM 191
            ......::||            |:||..|....|:           |..||.:|||     |...
Zfish   142 TSSAGTSSPL------------PLSPTQSPINLPSSLQPHALLLSPSPPSSPTHSL-----VRPR 189

  Fly   192 EDDSED------------------EENVWRPW 205
            |..|..                  :.::||||
Zfish   190 EQSSPPSSPSPQSPASLPPFFPGVDPSMWRPW 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)mgamma-HLHNP_524504.2 HLH 15..77 CDD:238036 27/60 (45%)
ORANGE 91..135 CDD:128787 19/51 (37%)
her8aNP_955918.3 HLH 17..75 CDD:238036 26/59 (44%)
Hairy_orange 95..133 CDD:284859 15/37 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170573649
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 92 1.000 Inparanoid score I5073
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1483774at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10985
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
87.860

Return to query results.
Submit another query.