DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)mgamma-HLH and Hes6

DIOPT Version :9

Sequence 1:NP_524504.2 Gene:E(spl)mgamma-HLH / 43151 FlyBaseID:FBgn0002735 Length:205 Species:Drosophila melanogaster
Sequence 2:NP_001013197.1 Gene:Hes6 / 316626 RGDID:1312047 Length:234 Species:Rattus norvegicus


Alignment Length:234 Identity:62/234 - (26%)
Similarity:99/234 - (42%) Gaps:75/234 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 QYRKVMKPMLERKRRARINKCLDELKDLMVATLESEGEHVTRLEKADILELTVTHLQKMKQQRQH 78
            ::.:..||::|:|||||||:.|.||:.|:..|     |...:||.|::|||||..:|...:.|..
  Rat    34 RFPQARKPLVEKKRRARINESLQELRLLLAGT-----EVQAKLENAEVLELTVRRVQGALRGRAR 93

  Fly    79 KRASGDESL--TPAEGFRSGYIHAVNEVSRSLSQLPGMNVSLGTQLMTHLGQRLNQIQPAEKEVL 141
            :|    |.|  ..:|.|.:|||..::||...:|....::.::..:|:.||.:.:           
  Rat    94 ER----EQLQAEASERFAAGYIQCMHEVHTFVSTCQAIDATVSAELLNHLLESM----------- 143

  Fly   142 PVTAPLSVHIANRDAYSVPISPI------SSY--AGSPNSNTSS--------------------- 177
                ||....:.||.....::.:      ||:  .|||.|..||                     
  Rat   144 ----PLREGSSFRDLLGDSLAGLPGGSGRSSWPPGGSPESPLSSPPGPGDDLCSDLEEIPEAELN 204

  Fly   178 -----------TSHSLLTTIDVTKMEDDSEDEENVWRPW 205
                       ||..:|||         :...::|||||
  Rat   205 RVPAEGPDLVPTSLGILTT---------ARRAQSVWRPW 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)mgamma-HLHNP_524504.2 HLH 15..77 CDD:238036 25/61 (41%)
ORANGE 91..135 CDD:128787 11/43 (26%)
Hes6NP_001013197.1 HLH 37..85 CDD:238036 24/52 (46%)
Hairy_orange 106..144 CDD:284859 10/52 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166334533
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 51 1.000 Inparanoid score I5369
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1483774at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
87.760

Return to query results.
Submit another query.