DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)mgamma-HLH and her3

DIOPT Version :9

Sequence 1:NP_524504.2 Gene:E(spl)mgamma-HLH / 43151 FlyBaseID:FBgn0002735 Length:205 Species:Drosophila melanogaster
Sequence 2:NP_571155.1 Gene:her3 / 30289 ZFINID:ZDB-GENE-980526-204 Length:229 Species:Danio rerio


Alignment Length:238 Identity:70/238 - (29%)
Similarity:102/238 - (42%) Gaps:61/238 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 SKTYQYRKVMKPMLERKRRARINKCLDELKDLMVATLESEGEHVTRLEKADILELTVTHLQKMKQ 74
            :|....:||.||::|:||||||||||::||.|:.:.. |......:|||||||||||.||:.:  
Zfish    11 AKPQNVKKVSKPLMEKKRRARINKCLNQLKSLLESAC-SNNIRKRKLEKADILELTVKHLRHL-- 72

  Fly    75 QRQHKRASGDESLTPAEGFRSGYIHAVNEVSRSL--SQLPGMNVSLGTQLMTHLGQRLN------ 131
              |:.:....::...|| :.:||...:|.||..|  |.....:.|:   ::|:|...||      
Zfish    73 --QNTKRGLSKACDSAE-YHAGYRSCLNTVSHYLRASDTDRDSRSI---MLTNLTSGLNHNRVPD 131

  Fly   132 ----QIQPAEKEVLPVTAPLSVHIANRDAYSVPISPISSYAGSPNSNTSSTSHSLL--------- 183
                :..||....||.|.        |..:.|||....||  |....|:.....|:         
Zfish   132 FSTVESDPALIFTLPSTL--------RRPHKVPIRTDVSY--SSFQQTAERKVCLMPKRTEIGDS 186

  Fly   184 --TTIDVTKMEDDSEDEE-------------------NVWRPW 205
              .::|......:|:..|                   |.||||
Zfish   187 DRMSLDAALRSQESKKAETTHFRPKDLKVIECCIFKQNYWRPW 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)mgamma-HLHNP_524504.2 HLH 15..77 CDD:238036 32/61 (52%)
ORANGE 91..135 CDD:128787 13/55 (24%)
her3NP_571155.1 HLH 17..77 CDD:238036 33/64 (52%)
ORANGE 88..129 CDD:128787 12/43 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170573638
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10985
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.