DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)mgamma-HLH and her1

DIOPT Version :9

Sequence 1:NP_524504.2 Gene:E(spl)mgamma-HLH / 43151 FlyBaseID:FBgn0002735 Length:205 Species:Drosophila melanogaster
Sequence 2:NP_571153.1 Gene:her1 / 30287 ZFINID:ZDB-GENE-980526-125 Length:328 Species:Danio rerio


Alignment Length:325 Identity:66/325 - (20%)
Similarity:116/325 - (35%) Gaps:128/325 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 EMSKTYQYRKVMKPMLERKRRARINKCLDELKDLMV-ATLESEGEHVTRLEKADILELTV----- 66
            :|:.....::::||::|:|||.|||:.|:||:.|:: .||:|..:: .:||||:||||.|     
Zfish     5 KMASRRPTKRILKPVIEKKRRDRINQRLEELRTLLLDNTLDSRLQN-PKLEKAEILELAVEYIRT 68

  Fly    67 --------------THLQK----MKQQRQHKRASGDESL----TPA------------------- 90
                          ||..|    :.::.|...||..||:    :|:                   
Zfish    69 KTATARDQGDSSKDTHDPKPPPLLSRRPQMPCASIPESIQTHNSPSNPIYKAGFKECISRSASFI 133

  Fly    91 --------EGFRSGYIHAVNEVSRSLSQ------------LPGMNVSLGTQLMTHLGQRLNQIQP 135
                    :.|..|..|.::..|.:|..            :|...:|..|.:.:....|.|....
Zfish   134 DCVEPSQRDSFVQGLCHHLDSYSSALPHGRVSSNPTHHPWIPNPELSCRTDVQSIGHMRANPEPY 198

  Fly   136 AEKEVLPVTAPLSVHIANRDAYSVP---ISPISS---------YAGSPN---------------- 172
            :....|...:.:.:|...:..|..|   |||..|         ::.||.                
Zfish   199 SYANSLYPKSFMHLHPTGQHPYLSPPYSISPPPSPGFSSSSPPFSSSPTYLSVPCQFPFPPSISP 263

  Fly   173 SNTSSTSHSLLTTIDV------------------TKMEDDSEDEEN--------------VWRPW 205
            .:|.|:|.|.|:|:.:                  |::......:.:              :||||
Zfish   264 HSTDSSSSSTLSTVSLSTTSLPVVPGPHLQVSSPTRVRFSGSVQSSQPRTLRRALFHNQPLWRPW 328

  Fly   206  205
            Zfish   329  328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)mgamma-HLHNP_524504.2 HLH 15..77 CDD:238036 28/85 (33%)
ORANGE 91..135 CDD:128787 10/55 (18%)
her1NP_571153.1 HLH 10..67 CDD:238036 25/57 (44%)
Hairy_orange 118..157 CDD:284859 3/38 (8%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170573809
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.