DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)mgamma-HLH and Hes1

DIOPT Version :9

Sequence 1:NP_524504.2 Gene:E(spl)mgamma-HLH / 43151 FlyBaseID:FBgn0002735 Length:205 Species:Drosophila melanogaster
Sequence 2:NP_077336.3 Gene:Hes1 / 29577 RGDID:62081 Length:281 Species:Rattus norvegicus


Alignment Length:263 Identity:68/263 - (25%)
Similarity:113/263 - (42%) Gaps:87/263 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 QYRKVMKPMLERKRRARINKCLDELKDLMVATLESEGEHVTRLEKADILELTVTHLQKMKQQRQH 78
            ::||..||::|::||||||:.|.:||.|::..|:.:....::||||||||:||.||:.:::.:..
  Rat    33 EHRKSSKPIMEKRRRARINESLSQLKTLILDALKKDSSRHSKLEKADILEMTVKHLRNLQRAQMT 97

  Fly    79 KRASGDESLTPAEGFRSGYIHAVNEVSRSLSQLPGMNVSLGTQLMTHLGQRLNQIQ--------- 134
            ...|.|.|:...  :|:|:...:|||:|.||...|:|..:.|:|:.||...:.||.         
  Rat    98 AALSTDPSVLGK--YRAGFSECMNEVTRFLSTCEGVNTEVRTRLLGHLANCMTQINAMTYPGQAH 160

  Fly   135 -------------------------------PAEKEVLPVTAPLSVH------------------ 150
                                           |......|.:||..:.                  
  Rat   161 PALQAPPPPPPSGPGGPQHAPFAPPPPLVPIPGGAAPPPGSAPCKLGSQAGEAAKVFGGFQVVPA 225

  Fly   151 --------IAN-RDAYSVPISPI-SSYAGS---PNSNTSSTSHSLLTTIDVTKMEDDSEDEENVW 202
                    |.| ..|:|.|:.|: :|.:|:   ||:.:.|:..||..              :::|
  Rat   226 PDGQFAFLIPNGAFAHSGPVIPVYTSNSGTSVGPNAVSPSSGSSLTA--------------DSMW 276

  Fly   203 RPW 205
            |||
  Rat   277 RPW 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)mgamma-HLHNP_524504.2 HLH 15..77 CDD:238036 28/61 (46%)
ORANGE 91..135 CDD:128787 16/83 (19%)
Hes1NP_077336.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..44 4/10 (40%)
bHLH-O_HES1_4 33..95 CDD:381465 28/61 (46%)
Hairy_orange 110..148 CDD:400076 14/37 (38%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 158..206 4/47 (9%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 255..281 9/39 (23%)
WRPW motif 276..279 2/2 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166334582
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000785
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10985
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.840

Return to query results.
Submit another query.