DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)mgamma-HLH and Hes7

DIOPT Version :9

Sequence 1:NP_524504.2 Gene:E(spl)mgamma-HLH / 43151 FlyBaseID:FBgn0002735 Length:205 Species:Drosophila melanogaster
Sequence 2:XP_038941367.1 Gene:Hes7 / 287423 RGDID:1305914 Length:358 Species:Rattus norvegicus


Alignment Length:173 Identity:45/173 - (26%)
Similarity:76/173 - (43%) Gaps:43/173 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 KVMKPMLERKRRARINKCLDELKDLMVATLESEGEHVTRLEKADILELTVTHLQKMKQ------- 74
            :::||::|::||.|||:.|:||:.|::.....:.....:||||:|||..|.:|::..:       
  Rat    43 EMLKPLVEKRRRDRINRSLEELRLLLLERTRDQNLRNPKLEKAEILEFAVGYLRERSRVEPPGTA 107

  Fly    75 ----QRQHKRASGDESLTPAEGFRSGYIHAVNEVSRSLSQLPGMNVSLGTQLMTHLGQRLNQIQP 135
                ||:.....|..:....||       |.:||.|.:.:.|.:           |...:|..:.
  Rat   108 RGVGQRREAGGWGARNARAGEG-------AGSEVDRGVGERPAV-----------LPDEVNNTRA 154

  Fly   136 AEKEVLPVTAPLSVHIAN-------------RDAYSV-PISPI 164
            .....||...||.||.|:             |.|.|: |:.|:
  Rat   155 CLSLCLPRCPPLHVHPASCLCLCARLTSVSLRPAPSLNPVGPL 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)mgamma-HLHNP_524504.2 HLH 15..77 CDD:238036 22/70 (31%)
ORANGE 91..135 CDD:128787 9/43 (21%)
Hes7XP_038941367.1 bHLH-O_HES7 44..102 CDD:381468 21/57 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166334622
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.