DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)mgamma-HLH and HEYL

DIOPT Version :9

Sequence 1:NP_524504.2 Gene:E(spl)mgamma-HLH / 43151 FlyBaseID:FBgn0002735 Length:205 Species:Drosophila melanogaster
Sequence 2:NP_055386.2 Gene:HEYL / 26508 HGNCID:4882 Length:328 Species:Homo sapiens


Alignment Length:230 Identity:59/230 - (25%)
Similarity:96/230 - (41%) Gaps:65/230 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 QMSEM--------SKTYQYRKVMKPMLERKRRARINKCLDELKDLMVATLESEGEHVTRLEKADI 61
            |:|:|        |...|.||..:.::|::||.|||..|.||:.|:....|.:|.  ::||||::
Human    25 QLSQMARPLSTPSSSQMQARKKHRGIIEKRRRDRINSSLSELRRLVPTAFEKQGS--SKLEKAEV 87

  Fly    62 LELTVTHLQKMKQQRQHKRASGDESLTPAEG----FRS-GYIHAVNEVSRSLSQLPGMNV---SL 118
            |::||.||:.:       .|:|......|..    ||| |:...:.||.|.|..|.|.:.   .:
Human    88 LQMTVDHLKML-------HATGGTGFFDARALAVDFRSIGFRECLTEVIRYLGVLEGPSSRADPV 145

  Fly   119 GTQLMTHLGQRLNQIQPAEKEVLPVTAP---------------LSVHIA-------------NRD 155
            ..:|::||.....:::|:.....|:..|               ||..:|             :..
Human   146 RIRLLSHLNSYAAEMEPSPTPTGPLAFPAWPWSFFHSCPGLPALSNQLAILGRVPSPVLPGVSSP 210

  Fly   156 AYSVP---ISPISSYAG---------SPNSNTSST 178
            ||.:|   .:|:....|         .|:...|||
Human   211 AYPIPALRTAPLRRATGIILPARRNVLPSRGASST 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)mgamma-HLHNP_524504.2 HLH 15..77 CDD:238036 23/61 (38%)
ORANGE 91..135 CDD:128787 13/51 (25%)
HEYLNP_055386.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..57 9/31 (29%)
Transcriptional repression and interaction with NCOR1 and SIN3A. /evidence=ECO:0000250 42..111 27/77 (35%)
HLH 42..100 CDD:238036 24/66 (36%)
ORANGE 115..162 CDD:128787 13/46 (28%)
Atrophin-1 <136..311 CDD:331285 19/110 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 239..308 3/7 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165140919
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.