DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)mgamma-HLH and HEY2

DIOPT Version :9

Sequence 1:NP_524504.2 Gene:E(spl)mgamma-HLH / 43151 FlyBaseID:FBgn0002735 Length:205 Species:Drosophila melanogaster
Sequence 2:NP_036391.1 Gene:HEY2 / 23493 HGNCID:4881 Length:337 Species:Homo sapiens


Alignment Length:207 Identity:61/207 - (29%)
Similarity:99/207 - (47%) Gaps:41/207 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SSLQMSEMSKTYQY--RKVMKPMLERKRRARINKCLDELKDLMVATLESEGEHVTRLEKADILEL 64
            |.::::..:.|.|.  ||..:.::|::||.|||..|.||:.|:....|.:|.  .:||||:||::
Human    33 SVIRLNSPTTTSQIMARKKRRGIIEKRRRDRINNSLSELRRLVPTAFEKQGS--AKLEKAEILQM 95

  Fly    65 TVTHLQKMKQQRQHKRASGDESLTPAEG----FRS-GYIHAVNEVSRSLSQLPGMNVS--LGTQL 122
            ||.|| ||.|      |:|.:....|..    |.| |:...:.||:|.||.:.|::.|  |..:|
Human    96 TVDHL-KMLQ------ATGGKGYFDAHALAMDFMSIGFRECLTEVARYLSSVEGLDSSDPLRVRL 153

  Fly   123 MTHLGQRLNQIQPAEKEVLPVTAPLSVHIANRDAYSVPISP---------ISSYAGSPNS--NTS 176
            ::||.....|     :|...:|:.::.|       ..|:.|         :.:....||.  .:.
Human   154 VSHLSTCATQ-----REAAAMTSSMAHH-------HHPLHPHHWAAAFHHLPAALLQPNGLHASE 206

  Fly   177 STSHSLLTTIDV 188
            ||...|.||.:|
Human   207 STPCRLSTTSEV 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)mgamma-HLHNP_524504.2 HLH 15..77 CDD:238036 27/63 (43%)
ORANGE 91..135 CDD:128787 15/50 (30%)
HEY2NP_036391.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..52 5/18 (28%)
bHLH-O_HEY2 40..121 CDD:381490 32/89 (36%)
Transcriptional repression and interaction with NCOR1 and SIN3A. /evidence=ECO:0000250 47..116 30/77 (39%)
ORANGE 119..165 CDD:128787 15/50 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 307..337
YRPW motif 327..330
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165140903
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.