DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment E(spl)mgamma-HLH and Usf2

DIOPT Version :9

Sequence 1:	NP_524504.2	Gene:	E(spl)mgamma-HLH / 43151	FlyBaseID:	FBgn0002735	Length:	205	Species:	Drosophila melanogaster
Sequence 2:	NP_035810.1	Gene:	Usf2 / 22282	MGIID:	99961	Length:	346	Species:	Mus musculus

Alignment Length:	122	Identity:	28/122 - (22%)
Similarity:	51/122 - (41%)	Gaps:	16/122 - (13%)

- Green bases have known domain annotations that are detailed below.

  Fly    16 RKVMKPMLERKRRARINKCLDELKDLMVATLESEGEHVTRLEKADILELTVTHLQKMKQQRQHKR 80
            |:.....:||:||.:||..:.:|..::........:  |...|..||.....::::::|..|..:
Mouse   236 RRAQHNEVERRRRDKINNWIVQLSKIIPDCHADNSK--TGASKGGILSKACDYIRELRQTNQRMQ 298

  Fly    81 ASGDESLTPAEGFRSGYIHAVNEVSR-SLSQLPGMNVSLGTQLMTH----LGQRLNQ 132
                |:...||..:..     ||:.| .:.:|...|..|..||..|    :|:...|
Mouse   299 ----ETFKEAERLQMD-----NELLRQQIEELKNENALLRAQLQQHNLEMVGESTRQ 346

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
E(spl)mgamma-HLH	NP_524504.2	HLH	15..77	CDD:238036	13/60 (22%)
E(spl)mgamma-HLH	NP_524504.2	ORANGE	91..135	CDD:128787	12/47 (26%)
Usf2	NP_035810.1	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1..44
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	215..244		1/7 (14%)
		bHLHzip_USF2	229..308	CDD:381493	17/77 (22%)
		ZapB	290..>334	CDD:399182	13/52 (25%)
		Leucine-zipper	307..328		5/25 (20%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.910