DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)mgamma-HLH and Bhlhe40

DIOPT Version :10

Sequence 1:NP_524504.2 Gene:E(spl)mgamma-HLH / 43151 FlyBaseID:FBgn0002735 Length:205 Species:Drosophila melanogaster
Sequence 2:NP_035628.1 Gene:Bhlhe40 / 20893 MGIID:1097714 Length:411 Species:Mus musculus


Alignment Length:220 Identity:55/220 - (25%)
Similarity:95/220 - (43%) Gaps:48/220 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSSLQMSEMSKTYQYRKVMK-------------PMLERKRRARINKCLDELKDLMVATLESEGEH 52
            :|.:..:.|.:.|:.|:.:|             .::|:|||.|||:|:.:||||:       .||
Mouse    25 LSGMDFAHMYQVYKSRRGIKRSEDSKETYKLPHRLIEKKRRDRINECIAQLKDLL-------PEH 82

  Fly    53 VT-----RLEKADILELTVTH---LQKMKQQRQHK-----------RASGDESLTPAEGFRSGYI 98
            :.     .||||.:||||:.|   |..:..|:|.|           ..||.......|.|.||:.
Mouse    83 LKLTTLGHLEKAVVLELTLKHVKALTNLIDQQQQKIIALQSGLQAGDLSGRNLEAGQEMFCSGFQ 147

  Fly    99 HAVNEVSRSLSQLPGMNVSLGTQLMTHLGQRLNQIQPAEKEVLPV-TAPLSVHIANRDAYSVPIS 162
            ....||.:.|::.........:||:|||.:.::::........|: :||.:|.:..:.::....|
Mouse   148 TCAREVLQYLAKHENTRDLKSSQLVTHLHRVVSELLQGGASRKPLDSAPKAVDLKEKPSFLAKGS 212

  Fly   163 --------PISSYAGSPNSNTSSTS 179
                    |:.....:|:....|.|
Mouse   213 EGPGKNCVPVIQRTFAPSGGEQSGS 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)mgamma-HLHNP_524504.2 bHLH-O_ESMB_like 9..77 CDD:381584 29/88 (33%)
ORANGE 91..135 CDD:128787 12/43 (28%)
Bhlhe40NP_035628.1 Essential for interaction with BMAL1, E-box binding and repressor activity against the CLOCK-BMAL1 heterodimer. /evidence=ECO:0000250 1..139 34/120 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..20
bHLH-O_DEC1 40..129 CDD:381592 29/95 (31%)
Necessary for interaction with RXRA and repressor activity against RXRA. /evidence=ECO:0000250 75..79 3/3 (100%)
ORANGE 140..184 CDD:128787 12/43 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 227..294 3/11 (27%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.