Sequence 1: | NP_524504.2 | Gene: | E(spl)mgamma-HLH / 43151 | FlyBaseID: | FBgn0002735 | Length: | 205 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_035628.1 | Gene: | Bhlhe40 / 20893 | MGIID: | 1097714 | Length: | 411 | Species: | Mus musculus |
Alignment Length: | 220 | Identity: | 55/220 - (25%) |
---|---|---|---|
Similarity: | 95/220 - (43%) | Gaps: | 48/220 - (21%) |
- Green bases have known domain annotations that are detailed below.
Fly 1 MSSLQMSEMSKTYQYRKVMK-------------PMLERKRRARINKCLDELKDLMVATLESEGEH 52
Fly 53 VT-----RLEKADILELTVTH---LQKMKQQRQHK-----------RASGDESLTPAEGFRSGYI 98
Fly 99 HAVNEVSRSLSQLPGMNVSLGTQLMTHLGQRLNQIQPAEKEVLPV-TAPLSVHIANRDAYSVPIS 162
Fly 163 --------PISSYAGSPNSNTSSTS 179 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
E(spl)mgamma-HLH | NP_524504.2 | HLH | 15..77 | CDD:238036 | 27/82 (33%) |
ORANGE | 91..135 | CDD:128787 | 12/43 (28%) | ||
Bhlhe40 | NP_035628.1 | Essential for interaction with ARNTL/BMAL1, E-box binding and repressor activity against the CLOCK-ARNTL/BMAL1 heterodimer. /evidence=ECO:0000250 | 1..139 | 34/120 (28%) | |
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..20 | ||||
bHLH-O_DEC1 | 40..129 | CDD:381592 | 29/95 (31%) | ||
Necessary for interaction with RXRA and repressor activity against RXRA. /evidence=ECO:0000250 | 75..79 | 3/3 (100%) | |||
ORANGE | 140..184 | CDD:128787 | 12/43 (28%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 207..294 | 5/31 (16%) | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C167830898 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG4304 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR10985 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
5 | 4.840 |