DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)mgamma-HLH and lin-22

DIOPT Version :9

Sequence 1:NP_524504.2 Gene:E(spl)mgamma-HLH / 43151 FlyBaseID:FBgn0002735 Length:205 Species:Drosophila melanogaster
Sequence 2:NP_500281.1 Gene:lin-22 / 177082 WormBaseID:WBGene00003008 Length:173 Species:Caenorhabditis elegans


Alignment Length:119 Identity:35/119 - (29%)
Similarity:62/119 - (52%) Gaps:15/119 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 KPMLERKRRARINKCLDELKDLMVATLESEGEHVTRLEKADILELTVTHLQKMKQQRQHKRASGD 84
            ||::|:||||||||.|.:||.:::..........::.|||||||:.|.:||:::..:....:...
 Worm    26 KPLMEKKRRARINKSLSQLKQILIQDEHKNSIQHSKWEKADILEMAVEYLQQLRSAQPCSLSPST 90

  Fly    85 ESL----TPAEGFR---------SGYIHAVNEVSRSLSQLPGMNVSLGTQLMTH 125
            .|:    ||.|..|         :.:::.:.:...:..||  ..:|:.|||..:
 Worm    91 SSISTPPTPKEEIRNIKVPLNPIASFLNPMMQQYVAYQQL--AQLSMYTQLFNN 142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)mgamma-HLHNP_524504.2 HLH 15..77 CDD:238036 24/56 (43%)
ORANGE 91..135 CDD:128787 8/44 (18%)
lin-22NP_500281.1 bHLH_O_HES 29..82 CDD:381416 22/52 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 65 1.000 Domainoid score I6616
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000785
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1011
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
76.770

Return to query results.
Submit another query.