DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)mgamma-HLH and Hes1

DIOPT Version :9

Sequence 1:NP_524504.2 Gene:E(spl)mgamma-HLH / 43151 FlyBaseID:FBgn0002735 Length:205 Species:Drosophila melanogaster
Sequence 2:NP_032261.1 Gene:Hes1 / 15205 MGIID:104853 Length:282 Species:Mus musculus


Alignment Length:264 Identity:68/264 - (25%)
Similarity:117/264 - (44%) Gaps:88/264 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 QYRKVMKPMLERKRRARINKCLDELKDLMVATLESEGEHVTRLEKADILELTVTHLQKMKQQRQH 78
            ::||..||::|::||||||:.|.:||.|::..|:.:....::||||||||:||.||:.:::.:..
Mouse    33 EHRKSSKPIMEKRRRARINESLSQLKTLILDALKKDSSRHSKLEKADILEMTVKHLRNLQRAQMT 97

  Fly    79 KRASGDESLTPAEGFRSGYIHAVNEVSRSLSQLPGMNVSLGTQLMTHLGQRLNQIQ--------- 134
            ...|.|.|:...  :|:|:...:|||:|.||...|:|..:.|:|:.||...:.||.         
Mouse    98 AALSTDPSVLGK--YRAGFSECMNEVTRFLSTCEGVNTEVRTRLLGHLANCMTQINAMTYPGQAH 160

  Fly   135 -----------------------PAEKEVLPV---------TAPLSVH----------------- 150
                                   |....::|:         :||..:.                 
Mouse   161 PALQAPPPPPPSGPAGPQHAPFAPPPPPLVPIPGGAAPPPGSAPCKLGSQAGEAAKVFGGFQVVP 225

  Fly   151 ---------IAN-RDAYSVPISPI-SSYAGS---PNSNTSSTSHSLLTTIDVTKMEDDSEDEENV 201
                     |.| ..|:|.|:.|: :|.:|:   ||:.:.|:..||.:              :::
Mouse   226 APDGQFAFLIPNGAFAHSGPVIPVYTSNSGTSVGPNAVSPSSGSSLTS--------------DSM 276

  Fly   202 WRPW 205
            ||||
Mouse   277 WRPW 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)mgamma-HLHNP_524504.2 HLH 15..77 CDD:238036 28/61 (46%)
ORANGE 91..135 CDD:128787 16/75 (21%)
Hes1NP_032261.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..44 4/10 (40%)
HLH 32..95 CDD:238036 28/61 (46%)
Hairy_orange 110..148 CDD:284859 14/37 (38%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 158..204 2/45 (4%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 256..282 9/39 (23%)
WRPW motif 277..280 2/2 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167830874
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000785
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10985
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.840

Return to query results.
Submit another query.