DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)mgamma-HLH and Bhlhe41

DIOPT Version :9

Sequence 1:NP_524504.2 Gene:E(spl)mgamma-HLH / 43151 FlyBaseID:FBgn0002735 Length:205 Species:Drosophila melanogaster
Sequence 2:XP_038964817.1 Gene:Bhlhe41 / 117095 RGDID:70900 Length:410 Species:Rattus norvegicus


Alignment Length:211 Identity:61/211 - (28%)
Similarity:95/211 - (45%) Gaps:53/211 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SLQMSEMSKTYQYRKVMKPMLERKRRARINKCLDELKDLMVATLESEGEHVT-----RLEKADIL 62
            ||:..:...||   |:...::|:|||.|||:|:.:||||:       .||:.     .||||.:|
  Rat    35 SLKRDDTKDTY---KLPHRLIEKKRRDRINECIAQLKDLL-------PEHLKLTTLGHLEKAVVL 89

  Fly    63 ELTVTHLQKMK--QQRQHKR----ASGDESL-TPA----EGFRSGYIHAVNEVSRSL-------- 108
            |||:.||:.:.  .::||::    .:|:.|| :|.    :.|.||:.....||.:.|        
  Rat    90 ELTLKHLKALTALTEQQHQKIIALQNGERSLKSPVQADLDAFHSGFQTCAKEVLQYLARFESWTP 154

  Fly   109 -----SQLPGMNVSLGTQLMTHLGQRLNQIQPAEKEVLPVTAPLSVHIA-----NRDAYSVPISP 163
                 :||.....::.|||:|      .|:.|...   |..||.|...|     .|.|..||:..
  Rat   155 REPRCAQLVSHLHAVATQLLT------PQVTPGRG---PGRAPCSAGAAAASGSERVARCVPVIQ 210

  Fly   164 ISSYAGSPNSNTSSTS 179
            .:.....|..:|.:.|
  Rat   211 RTQPGTEPEHDTDTDS 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)mgamma-HLHNP_524504.2 HLH 15..77 CDD:238036 25/68 (37%)
ORANGE 91..135 CDD:128787 13/56 (23%)
Bhlhe41XP_038964817.1 bHLH-O_DEC2 31..122 CDD:381593 34/96 (35%)
ORANGE 129..175 CDD:128787 11/45 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166334566
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10985
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.