DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)mgamma-HLH and LOC116412194

DIOPT Version :9

Sequence 1:NP_524504.2 Gene:E(spl)mgamma-HLH / 43151 FlyBaseID:FBgn0002735 Length:205 Species:Drosophila melanogaster
Sequence 2:XP_031761713.1 Gene:LOC116412194 / 116412194 -ID:- Length:155 Species:Xenopus tropicalis


Alignment Length:198 Identity:50/198 - (25%)
Similarity:79/198 - (39%) Gaps:62/198 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 KTYQYRKVMKPMLERKRRARINKCLDELKDLMVATLESEGEHV-TRLEKADILELTVTHLQKMKQ 74
            |....||:.||::|:.||.|||..:::|:  |:...|.|..|: ::.|||||||:.|:.||    
 Frog    17 KAQGIRKMRKPVVEKMRRDRINSSIEQLR--MLLEKEFESHHLPSKPEKADILEMAVSFLQ---- 75

  Fly    75 QRQHKRAS-GDESLTPAEGFRSGYIHAVNEVS-RSLSQLPGMNVSLGTQLMTHLGQRLNQIQPAE 137
              ||.... ...||...||....:..::..|| ::.|:.|        :.:.|     |..:...
 Frog    76 --QHMATKYAQSSLVQIEGHSKYHQDSLQFVSPKNQSEFP--------EKLLH-----NFYEDHS 125

  Fly   138 KEVLPVTAPLSVHIANRDAYSVPISPISSYAGSPNSNTSSTSHSLLTTIDVTKMEDDSEDEENVW 202
            ..|.|..:||         |..|                    :..||...:|:         :|
 Frog   126 VAVSPPLSPL---------YQTP--------------------TKCTTPGPSKV---------IW 152

  Fly   203 RPW 205
            ||:
 Frog   153 RPF 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)mgamma-HLHNP_524504.2 HLH 15..77 CDD:238036 25/62 (40%)
ORANGE 91..135 CDD:128787 8/44 (18%)
LOC116412194XP_031761713.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1011
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.