DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)mgamma-HLH and her4.4

DIOPT Version :9

Sequence 1:NP_524504.2 Gene:E(spl)mgamma-HLH / 43151 FlyBaseID:FBgn0002735 Length:205 Species:Drosophila melanogaster
Sequence 2:NP_001121862.1 Gene:her4.4 / 100149066 ZFINID:ZDB-GENE-081031-104 Length:152 Species:Danio rerio


Alignment Length:196 Identity:52/196 - (26%)
Similarity:77/196 - (39%) Gaps:57/196 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 KTYQYRKVMKPMLERKRRARINKCLDELKDLMVATLESEGEHVTRLEKADILELTVTHLQKMKQQ 75
            :|....|:.|||:|:.||.|||..:::||.|:......: :..:|.|||||||:|:..|::    
Zfish    13 ETLLTNKLRKPMVEKIRRERINSSIEKLKTLLAQEFVKQ-QPDSRQEKADILEMTLDFLRR---- 72

  Fly    76 RQHKRASGDESLTPAEGFRSGYIHAVNEVSRSLSQLPGMNVSLGTQLMTHLGQRLNQIQ-PAEKE 139
            .|...|:||           |....|.|....|||.|     :.||..|.|.:....:| ||::.
Zfish    73 SQKSSAAGD-----------GRSRCVQEAVSFLSQCP-----VQTQSHTRLMKLFLHMQTPADQH 121

  Fly   140 VLPVTAPLSVHIANRDAYSVPISPISSYAGSPNSNTSSTSHSLLTTIDVTKMEDDSEDEENVWRP 204
            ........:...||               .|...:|.:.||                    :|||
Zfish   122 TRVDNPQTTEKHAN---------------SSAKQHTPARSH--------------------IWRP 151

  Fly   205 W 205
            |
Zfish   152 W 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)mgamma-HLHNP_524504.2 HLH 15..77 CDD:238036 23/61 (38%)
ORANGE 91..135 CDD:128787 12/44 (27%)
her4.4NP_001121862.1 HLH 19..75 CDD:238036 23/60 (38%)
ORANGE 77..123 CDD:128787 17/61 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170573755
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.