DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment E(spl)mgamma-HLH and lrrk2

DIOPT Version :9

Sequence 1:	NP_524504.2	Gene:	E(spl)mgamma-HLH / 43151	FlyBaseID:	FBgn0002735	Length:	205	Species:	Drosophila melanogaster
Sequence 2:	XP_002932250.3	Gene:	lrrk2 / 100145062	XenbaseID:	XB-GENE-5768572	Length:	2514	Species:	Xenopus tropicalis

Alignment Length:	132	Identity:	30/132 - (22%)
Similarity:	45/132 - (34%)	Gaps:	52/132 - (39%)

- Green bases have known domain annotations that are detailed below.

  Fly    25 RKRRAR------INKCLDELKDLMVATLESE---------GEHVTRLE----------------- 57
            |::.||      |.||.:|:..|::..|..:         |.|:.|.|
Frog   764 REQDARKALNVSIKKCDNEIISLLLKKLGLDAANNSICLGGFHIGRTEPSWLIPLFTEKQPLLKQ 828

  Fly    58 --------KADILELTVTHLQKMKQQRQHKRASGDESLTPAEGFRSGYIHAVNEVSRSLSQLPGM 114
                    |..||...|....:...:.:..|:|||.|.|..       ||..:|.|     ||.:
Frog   829 PSVDQEGKKGSILARMVLRYHRKNSEIERCRSSGDLSFTEE-------IHEKSEDS-----LPHL 881

  Fly   115 NV 116
            :|
Frog   882 DV 883

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
E(spl)mgamma-HLH	NP_524504.2	HLH	15..77	CDD:238036	17/91 (19%)
E(spl)mgamma-HLH	NP_524504.2	ORANGE	91..135	CDD:128787	7/26 (27%)
lrrk2	XP_002932250.3	LRR	957..1273	CDD:227223
		leucine-rich repeat	977..1004	CDD:275380
		leucine-rich repeat	1005..1028	CDD:275380
		leucine-rich repeat	1029..1051	CDD:275380
		leucine-rich repeat	1052..1076	CDD:275380
		leucine-rich repeat	1077..1100	CDD:275380
		leucine-rich repeat	1101..1122	CDD:275380
		leucine-rich repeat	1123..1146	CDD:275380
		leucine-rich repeat	1147..1189	CDD:275380
		leucine-rich repeat	1190..1213	CDD:275380
		leucine-rich repeat	1214..1238	CDD:275380
		P-loop_NTPase	1326..1499	CDD:422963
		COR	1516..1732	CDD:406489
		STKc_LRRK2	1876..2127	CDD:270970
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	1	0.930	-	-		C165161026
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.930