DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)mgamma-HLH and hes2

DIOPT Version :9

Sequence 1:NP_524504.2 Gene:E(spl)mgamma-HLH / 43151 FlyBaseID:FBgn0002735 Length:205 Species:Drosophila melanogaster
Sequence 2:XP_002933889.1 Gene:hes2 / 100038090 XenbaseID:XB-GENE-486138 Length:191 Species:Xenopus tropicalis


Alignment Length:202 Identity:54/202 - (26%)
Similarity:89/202 - (44%) Gaps:47/202 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 QYRKVMKPMLERKRRARINKCLDELKDLMVATLESEGEHVTRLEKADILELTVTHLQKMKQQRQH 78
            :.||.:||::|::||||||:.|::||.|::..:..:....::||||||||:||..|:.:...   
 Frog    27 ELRKTLKPLMEKRRRARINESLNQLKTLILPLIGKDNSRYSKLEKADILEMTVRFLRDIPPV--- 88

  Fly    79 KRASGDESLTPAEGFRSGYIHAVNEVSRSLSQLPGMNVSLGTQLMTHLGQRLNQIQPAEKEVLPV 143
                  .:..||:.::.||...|..:|..|::...:......:|:.|| ||              
 Frog    89 ------PAQNPADRYKEGYRACVERLSAILNKSHVLTGEASNRLLNHL-QR-------------- 132

  Fly   144 TAPLSVHIANRDAYSVP----------ISPISSYAGSPNSNTSSTSHSLLTTIDVTKMEDDSEDE 198
                |..:...|.:..|          :||.:|...||..|..| ||        .......:..
 Frog   133 ----SPELCCSDCHHPPKSHSPRIVLHVSPRTSQLESPLLNQPS-SH--------RPAPCPPQLN 184

  Fly   199 ENVWRPW 205
            .::||||
 Frog   185 SSIWRPW 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)mgamma-HLHNP_524504.2 HLH 15..77 CDD:238036 26/61 (43%)
ORANGE 91..135 CDD:128787 10/43 (23%)
hes2XP_002933889.1 bHLH-O_HES2 25..89 CDD:381469 26/70 (37%)
Hairy_orange 97..133 CDD:369405 10/54 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000785
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10985
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.